KEGG   Mus musculus (house mouse): 218734
Entry
218734            CDS       T01002                                 
Symbol
Cep15, 3830406C13Rik
Name
(RefSeq) centrosomal protein 15
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF4570 PEX11
Other DBs
NCBI-GeneID: 218734
NCBI-ProteinID: NP_001271312
MGI: 1917937
Ensembl: ENSMUSG00000033111
UniProt: Q8BGD0
Position
14:complement(10147278..10185610)
AA seq 127 aa
MASLFTQEIHLSKRHEEILSQRLMLLQKMKNKFGDENTERASLLQATETASRRNLRLLKD
IDAAEEAFQTKLIPHPQPSMLSLETRYWASVEEHIPKWELFLLGRAPYPIGAENQNEVPF
VQTEAKL
NT seq 384 nt   +upstreamnt  +downstreamnt
atggcttccttgtttactcaagaaattcacctttctaaaagacatgaagaaatattatca
caaagattaatgttacttcagaaaatgaaaaacaaatttggagatgaaaacacagaaagg
gcatctctcctccaagccactgagactgcttctagaagaaacctccgactcttgaaggac
atagatgctgcagaggaggcttttcagaccaagcttatcccacacccacagccttcgatg
ctttctcttgagactcgttactgggcatcagtagaagaacatatccccaagtgggaactg
tttcttttaggaagagcaccatatccaattggtgctgaaaatcaaaatgaggtaccattc
gttcaaaccgaggcaaagttgtaa

DBGET integrated database retrieval system