KEGG   Mus musculus (mouse): 218772Help
Entry
218772            CDS       T01002                                 

Gene name
Rarb, A830025K23, Hap, Nr1b2
Definition
(RefSeq) retinoic acid receptor, beta
  KO
K08528  retinoic acid receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    218772 (Rarb)
   05226 Gastric cancer
    218772 (Rarb)
   05222 Small cell lung cancer
    218772 (Rarb)
   05223 Non-small cell lung cancer
    218772 (Rarb)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    218772 (Rarb)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   218772 (Rarb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 218772
NCBI-ProteinID: NP_001276689
MGI: 97857
Ensembl: ENSMUSG00000017491
UniProt: P22605 Q6DFX0
Structure
PDB: 

Position
14 A2; 14 7.08 cM
AA seq 482 aa AA seqDB search
MSTSSHACPVPAVRGHMTHYPAAPYPLLFPPVIRGLSLPPLHGLHGHPPPSGCSTPSPAS
VGQACQRTTGGSQFAASTKWTPSLNAAIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQD
KSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGM
SKESVRNDRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSS
ADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRI
CTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAIC
LICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAE
RVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNIAEHSPSVSPSSVENSGVSQSPL
LQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagcagccacgcatgcccagtcccggcagtgcgtggacacatgactcactac
ccagctgcaccctacccattactgttcccccctgtcatcagaggactctccctgcctcca
ctccatgggctccatggccacccacctcccagtggatgcagcaccccatcaccagccagt
gtggggcaggcatgtcagaggacaactggtggaagtcagtttgcagcttctaccaagtgg
acaccaagcttgaatgcagccatcgagacacagagtaccagctctgaggagctcgtcccg
agcccaccatctccacttcctcctcctcgggtgtacaagccctgcttcgtttgccaggac
aagtcatcgggctaccactatggcgtcagtgcctgcgaggggtgcaagggctttttccgc
agaagtattcagaagaacatgatctacacttgccatcgagataagaactgcgtcattaac
aaggtcactaggaaccgatgccagtactgccgcctgcagaagtgctttgaagtgggcatg
tccaaagagtctgttaggaatgacaggaacaagaaaaagaaggagccttcaaagcaggaa
tgcacagagagctatgagatgacagcggagctagacgacctcactgagaagatccggaaa
gcccaccaggaaacctttccctcactctgccagctgggtaaatacaccacgaattccagc
gctgaccaccgggtccgattggacttgggcctctgggacaaattcagtgagctggccacc
aagtgcattattaagatcgtggagttcgccaagcgtctgccgggcttcacaggtctgacc
atcgcagaccagatcaccctgctcaaagccgcctgcttggatatcttgattctcagaatt
tgtaccaggtataccccagagcaagacaccatgactttctctgatggccttacactaaat
cgaactcagatgcacaatgctggcttcggtcctctgactgaccttgtgttcacctttgcc
aaccagctcctgcctttggaaatggatgacacagaaacaggccttctcagtgccatctgt
ttaatctgtggagaccgccaggaccttgaggaaccaacaaaagtagacaagctccaagaa
ccactgctggaagcactaaagatttacattagaaaacgacgacccagcaagcctcacatg
tttccaaagatcttaatgaaaatcacagatctccgcagcatcagcgcgaaaggtgccgaa
cgtgtaattaccttgaaaatggaaattcctggatcaatgccacctctcattcaggaaatg
ctggagaattctgaaggacatgaacccttgaccccaagttcaagtgggaatatagcagag
cacagtcccagcgtgtcccccagctcagtggagaacagtggagtcagtcagtcaccactg
ctgcagtga

DBGET integrated database retrieval system