KEGG   Mus musculus (mouse): 218832
Entry
218832            CDS       T01002                                 

Gene name
Polr3a, 9330175N20Rik, BC053071, RP, RPC1, RPC155
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide A
  KO
K03018  DNA-directed RNA polymerase III subunit RPC1 [EC:2.7.7.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    218832 (Polr3a)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    218832 (Polr3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    218832 (Polr3a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     218832 (Polr3a)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     218832 (Polr3a)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 218832
NCBI-ProteinID: NP_001074716
MGI: 2681836
Ensembl: ENSMUSG00000025280
UniProt: B2RXC6
Position
14; 14 A3
AA seq 1390 aa
MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM
GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE
EKQQFLDFLKRPGLTYLQKRGLKKKISDKCRKKSTCHYCGAFNGTVKKCGLLKIIHEKYK
TNKKVVDPIVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLM
NPESGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISG
AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKR
VDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPDVHPGANF
IQQRHMQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARV
KPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIA
AIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI
FSVILRPSDDNPVRANLRTKGKQYCGKGEDLCVNDSYVTIQNSELMCGSMDKGTLGSGSK
NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAG
YKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTM
ALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYS
GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF
IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVYPCQTEPALSKNDLTLTAEAIMKKNEFLC
CQDSFLQEIKTFIKGVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITPTQIEKFLETCRD
KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI
STPIITAQLDKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL
RLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV
VQGIPEVSRAVIHIDEQSGKEKFKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI
EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLAS
FEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKANRDPKPPRRPLIFD
THEFHIPLVT
NT seq 4173 nt   +upstreamnt  +downstreamnt
atggtgaaggagcagttccgcgagacggatgtggctaagaaaataagccatatctgtttt
ggaatgaagtcccctgaggagatgcgccagcaggcacatatccaggttgtcagtaagaac
ctgtacagccaagacaacaaccacgcccccttgttgtatggagtgcttgaccatagaatg
ggtacgagcgaaaaagatcgtccttgtgagacctgtgggaagaacttggcggactgtctc
ggccactatggctacattgatctcgagctaccgtgctttcatgtcgggtacttcagggct
gtcattggtatcttacagatgatctgcaaaacctgctgccacattatgctgtcccaggaa
gagaagcagcagtttctagattttctgaagaggcctggcctaacctacctgcagaagcga
ggcctgaagaagaagatctcagataaatgccggaagaaaagcacttgtcactactgtggt
gcctttaatggtaccgtaaagaaatgtggtttactgaagataattcatgaaaaatacaag
acaaacaaaaaagtcgtggatcccattgtatcaaacttcctgcagtcctttgagacagcc
attgagcataacaaagaggttgaacccctgctgggaagggcccaggagaacttgaatcct
ttagtagttctgaacttgtttaagcgcatcccagctgaagatgtcccgttactcctgatg
aacccagaatctggaaagccctctgatttgattctcacccgacttttggtgcctcccctg
tgtatcagaccgtccgtcgtgagtgatctgaagtctggaaccaatgaagatgacctgaca
atgaaactgacagagatcattttcctaaatgatgttattaaaaagcaccggatctccgga
gccaagacgcagatgatcatggaggactgggatttcctgcagctgcagtgtgccctctac
atcaacagtgagctctctggcatccctctcaacatggcacctaagaaatggacgcgaggc
tttgtgcagcgcctgaaggggaaacagggtcgatttagaggtaatctgtcagggaagagg
gtggatttctccggccgaacagtcatctcacctgaccccaacctccggattgatgaagta
gccgtgccagttcatgtggccaaaattctaacttttcctgagaaggtgaacaaagcaaac
atcaactttttgaggaaactggttcgaaatggcccagatgttcacccaggagccaatttt
atccaacaaagacacatgcagatgaagaggttcctgaagtatggaaatcgggaaaagatg
gctcaggagctcaagttcggcgacattgtagagagacacctgatagatggagatgtggtc
ttgttcaaccggcagccctccctgcacaaactgagcatcatggcccacctggccagggtt
aagccccaccggaccttcagattcaatgaatgtgtctgcaccccctacaatgcagacttt
gatggggatgaaatgaaccttcatcttccccagacagaggaagccaaagcagaggccctt
gttctcatggggaccaaagcgaaccttgtaaccccacgaaatggggagccactcattgct
gccattcaggacttcttaacaggtgcttacctcctcaccctcaaggacaccttctttgac
cgagccaaggcttgccagatcatcgcttcaatactggttggcaaagatgaaaaaattaaa
gtgcgcctcccaccccctacaatactaaagcctgtcaccctgtggaccggaaagcagatc
ttcagtgtcatcctcagacctagtgatgacaatccagtgcgggccaacctccgaaccaag
ggcaagcagtactgtggcaagggggaagacctctgcgtcaacgactcctatgtcaccatc
cagaacagtgagttgatgtgcggcagcatggacaaagggaccctggggtcggggtccaag
aacaacatcttctacatcttgctacgagactgggggcagaatgaggctgccgatgccatg
tctcggcttgccaggctggctcctgtctacctgtctaaccgtgggttctccatcgggatt
ggtgatgtcacgcctggccagggactgctgaaagccaagtatgagctactaaatgctggc
tacaaaaaatgtgacgagtacattgaagccctgaacacaggcaagctgcagcagcagcca
ggctgcacggccgaggagacgcttgaggctctgatcctgaaggagctgtctgtgatccgg
gaccatgctggcagtgcctgcctccgcgagctggacaagagcaacagccccctcaccatg
gccctgtgtggctccaaaggttccttcataaacatatcacagatgattgcctgtgtggga
cagcaagccatcagtggctcccgggttccagatggctttgagaacagatctttgcctcac
tttgagaagcattcaaagctccctgctgccaaaggctttgtggccaatagcttttactct
ggcttaacgcctactgagtttttcttccacacaatggccggtcgggagggtctggtggac
acagctgtaaagactgctgaaacaggatacatgcagagaagactggtcaaatccctggaa
gacctctgctcgcagtacgatctgacagtgcggagctccaccggtgacatcatccagttc
atctatggaggagatggcttagatcctgctgccatggagggcaaagacgaaccgctggag
tttaagcgggttctggacaacatcaaggcagtgtatccatgtcagactgaacctgctctc
agtaagaacgacctcaccttgaccgctgaggccatcatgaagaagaatgagttcctatgc
tgccaagacagcttcctgcaggaaataaaaacattcattaaaggggtgtccgagaagatt
aagaaaaccagagataaatatgggatcaatgataacggcacaacagagcctcgtgtgctg
taccagttggaccgtattacccctacccaaatagagaagtttctggagacctgtagggat
aagtatatgagagcacagatggagccaggctctgcggtaggtgcactctgtgcacagagc
attggtgagcccggcacccagatgacgctgaagacattccactttgcaggagtagcctcc
atgaacatcaccctgggtgtgcctcggatcaaagagatcatcaacgcttccaaggccatc
agcactccaattatcacagcacagctagacaaggatgacgacgcggattatgcacgcctg
gtgaagggcaggattgagaaaaccctcctgggggagatctcagagtatattgaagaagtg
tttcttcctgatgactgctttattcttgtcaagctctccctggaacggatccgacttctg
agactggaggtcaatgctgagacagtgcggtactccatctgcacatccaagctccgagtg
aagcctggtgatgtggccgttcatggggaggctgtggtgtgtgtcacccccagggaaaac
agcaagagctccatgtattatgtgctgcagtttctcaaagaggatctgcccaaggtggtt
gtacaaggcatcccagaggtgtcgcgagctgtcatccatattgacgagcagagtgggaag
gagaagttcaagcttctggtggaaggtgacaacctgcgggcagtcatggccacccacggt
gtgaaaggcacccggaccacgtctaataacacctatgaggtggaaaaaaccctgggcatt
gaggctgcccggacaactatcatcaacgagatccagtacacgatggtcaaccacggcatg
agcatcgacaggaggcacgtgatgctgctctctgacctgatgacctacaagggtgaagtc
ctgggtataaccaggtttggcctggccaagatgaaggagagtgtgttgatgctggcctcc
tttgaaaagacagctgaccatctctttgatgctgcctactttgggcagaaagactctgta
tgcggagtgtctgagtgcatcatcatgggaatcccgatgaacatcggaactgggctcttc
aagctgttacacaaagccaacagggaccccaaaccacccaggagacccctgatatttgac
acacatgaattccacatccctcttgttacatag

DBGET integrated database retrieval system