KEGG   Mus musculus (mouse): 21887Help
Entry
21887             CDS       T01002                                 

Gene name
Tle3, 2610103N05Rik, ESG, Grg3a, Grg3b, mKIAA1547
Definition
(RefSeq) transducin-like enhancer of split 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ Ribosomal_S18
Motif
Other DBs
NCBI-GeneID: 21887
NCBI-ProteinID: NP_033415
MGI: 104634
Ensembl: ENSMUSG00000032280
Vega: OTTMUSG00000035108
UniProt: Q08122 Q80TC1
Position
9; 9 B
AA seq 772 aa AA seqDB search
MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELN
AIIGQQQLQAQHLSHATHGPPVQLPPHPSGLQPPGIPPVTGSSSGLLALGALGSQAHLAV
KDEKNHHELDHRERESSTNNSVSPSESLRASEKHRGSADYSMEAKKRKAEEKDSLSRYDS
DGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARGLKKDAPTSPASVASSSSTPSSK
TKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPIGIMASALRTP
ITLTSSYPAPFAMMSHHEMNGSLTSPSAYAGLHNIPSQMSAAAAAAAAAYGRSPMVSFGA
VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQI
NTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKL
LPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNI
AVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTS
QIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGK
DNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgtatccgcaaggcagacatccggcaccccatcaacccgggcagccgggatttaaattc
actgtggccgagtcctgtgacaggatcaaagacgaattccagttcctgcaagctcagtat
cacagcctcaaagtggagtatgacaagctggctaacgagaagacggagatgcagcgccat
tatgtgatgtactatgagatgtcctatggcttgaatattgaaatgcacaagcagacagag
attgcgaagagactgaacacaatcctagcccagatcatgccttttttgtcacaggagcat
cagcagcaagtggcgcaggctgtggaacgcgccaagcaggtcaccatgacggagttgaac
gccatcatcgggcagcagcaactccaggcccagcacctctcccatgccacgcatggtccc
ccggtccagctgccaccccacccgtcaggcctccagcctcctgggattcccccagtgaca
ggaagcagctctgggttgctggcacttggtgccctgggaagtcaagctcacttggcggtg
aaggatgagaagaaccaccatgaactggatcacagagagagagagtccagcacgaacaat
tccgtgtcaccctctgaaagcctccgggccagtgagaagcaccggggctctgcagactac
agcatggaagccaagaagcggaaggcggaagagaaagacagcctcagcagatacgatagc
gatggggacaagagtgacgacctggtggtggatgtctctaatgaggacccagcaacaccc
cgggtgagcccagcacactcccctcctgaaaatgggctggacaaagcccgtggtctgaag
aaagatgcccccaccagcccagcctccgtggcttcctccagcagcacaccttcctccaag
accaaagaccttggtcataatgacaaatcttccacacctgggctcaagtccaacacacca
acgccaagaaatgatgccccaactccaggcaccagcaccaccccggggctccggtcaatg
ccgggcaaacctccaggcatggacccgataggtataatggcctcggccctgcgaacaccc
atcaccctcaccagctcctatccagcaccctttgccatgatgagccaccacgagatgaat
ggctccctcaccagcccaagcgcctatgctggcctacacaacatcccatcccagatgagc
gccgccgcagccgctgcagccgccgcctatggccgatcgccaatggtgagctttggagct
gttggttttgaccctcaccccccaatgagggccacaggcctgccttccagtctcgcctcc
attcctggagggaaaccggcatactccttccatgtgagtgctgatgggcagatgcaacct
gtgcccttcccccatgatgcactagcaggccctggcattcccaggcatgcccggcagatc
aatacgctcagccatggagaggtggtatgtgctgtgaccatcagcaaccccacacgacac
gtctacacaggcggcaagggctgtgtgaagatatgggacatcagccagccgggcagcaag
agtcccatctcccagctggactgcctgaacagggacaactacatccgctcgtgcaagctt
ctccccgatgggcgcacgctcattgtgggtggtgaggccagcacgctcaccatctgggac
ctggcctcacccacaccccgcatcaaggctgagctgacgtcctcggctccagcctgttat
gccctggccatcagtcctgatgccaaagtctgtttttcctgctgcagcgacgggaacatt
gcggtttgggatctgcacaaccagaccctggtcaggcagttccagggccacacagatggg
gccagctgtatagacatctctcatgatggcactaagctgtggaccgggggcctggacaac
accgtgcgctcctgggacctacgtgaaggacggcagttacagcaacacgatttcacctcc
cagatcttctccctgggttactgccccactggggagtggctggccgtgggcatggagagc
agcaatgtggaggtcctgcaccacactaagcccgacaaataccagctgcacctgcacgag
agctgcgtgctgtccctcaagttcgcctattgtggcaagtggtttgtgagcactgggaaa
gacaaccttctcaatgcctggaggacgccttatggagccagcatcttccagtcaaaagaa
tcctcatctgtcttgagctgtgacatttcagcggatgacaaatatattgtaacaggctct
ggtgacaagaaggccacagtttacgaggtcatctactga

DBGET integrated database retrieval system