KEGG   Mus musculus (house mouse): 218877
Entry
218877            CDS       T01002                                 
Symbol
Sema3g, AK129018
Name
(RefSeq) sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3G
  KO
K06840  semaphorin 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    218877 (Sema3g)
SSDB
Motif
Pfam: Sema ig Ig_6 Ig_3 PSI Ig_2 I-set
Other DBs
NCBI-GeneID: 218877
NCBI-ProteinID: NP_001020550
MGI: 3041242
Ensembl: ENSMUSG00000021904
UniProt: Q4LFA9
Position
14:30939830..30952309
AA seq 780 aa
MDPSAWAICCLLGSLLFHVGIPSPGPSPSVPRLRLSYRDLLSTNRSAIFLGPRGSLDLQV
MYLDEYRDRLFLGSRDALYSLRLDQAWPDPREVLWLPQPGQKVECVRKGKDPLTECANFV
RVLQPHNRTHLLACGTGAFQPICTFITVGHRGEHVLRLDASSVENGRGRCPHEPSRPFAS
TFVGGELYTGLTADFLGREAMIFRSGGPRPALRSDSDQSLLHEPRFVMAARIPDNSDRDD
DKVYFFFSETVPSPDGGPGHVTISRVGRVCVNDAGGQRVLVNKWSTFLKARLVCSVPGPG
GAETHFDQLEDVFLLWPKAGKSLEVYALFSTVSAVFQGFAVCVYHMVDIWEVFNGPFAHR
DGPQHQWGPYGGKVPFPRPGVCPSKMTAQPGRPFGSTKDYPDEVLQFVRDHPLMFQPVRP
RRGRPVLVKTHLAQRLRQIVVDRVEAEDGTYDVIFLGTDSGSVLKVIALQGGGLTEPEEV
VLEELQVFKVPTPITEMEISVKRQTLYVGSPLGVARLQLHQCETYGSACAECCLARDPYC
AWDGTACARYRPSSGKRRFRRQDIRHGNPAVQCLGQGQSQNKAASGLMTRVFGTEHNSTF
LECLPKSPQAAVRWFLQRPGDKGTDQVKTDERVVQTAQGLLFRRLSRHDAGNYTCTTLEH
GFSQTVVRFALEVIAAVQLDSLFLRESRLEEPSAWGSLASASPKTWYKDILQLTGFANLP
RVDEYCERVWCRGVGERSGSFRGKGKQAKGKSWAGLELGKKMKSRVLAEHNRTPREVEAT
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggacccatctgcgtgggccatctgctgcctcctggggagccttctgttccatgtgggc
atccccagccctggtcccagccccagtgtgcctcgtctgcggctctcctacagagatctc
ctgtctaccaaccgctctgccatctttctgggcccacggggttccctagacctccaagtc
atgtacctggatgagtatcgagatcgcctctttctgggaagccgagatgccctttactct
ctgagactggatcaggcatggccagacccccgggaggtcttgtggctgccacagccagga
cagaaggtggaatgtgtccgcaagggaaaagaccctttgacggagtgtgccaacttcgtg
cgggtcttacaaccccataaccggacccatctgctggcctgtggcacaggagccttccaa
cccatctgcaccttcatcacagtggggcatcgaggggagcatgtgctccgcttggatgct
agcagcgtcgagaatggaagggggcgttgcccacatgagcccagccgacccttcgccagc
acctttgtaggtggggagctatacacaggtctcactgccgatttcctgggacgtgaggcc
atgattttccggagtgggggtccccgaccagccctgcgttctgactctgaccagagcctc
ctacatgaaccccggtttgtgatggctgctcggatcccagataactctgaccgggacgac
gacaaggtgtacttcttcttctccgagactgtcccgtcaccagatggtggcccaggtcat
gtcaccatcagccgagtgggccgcgtctgtgtgaatgatgctggtggccagcgggtgctg
gtgaacaaatggagcactttcctcaaggcccggctggtgtgctctgtgcctggcccgggt
ggggctgagactcactttgaccagctagaggatgtgttcctgctgtggcccaaggccggg
aagagcctcgaggtgtatgcgctgttcagcactgtcagtgctgtgttccagggctttgct
gtctgtgtgtaccacatggtagacatctgggaggtcttcaatgggccctttgcccaccga
gatggccctcagcatcagtggggaccctatgggggcaaggtgcccttccctcgccccggt
gtgtgtcctagcaagatgaccgcacagccaggccgaccctttggcagcaccaaggactac
ccagacgaggtgttgcagtttgtccgagaccacccactcatgttccagcctgtgaggcct
cggcgtggccgccctgtcctggtcaaaactcacttggctcagcgactgcgccagattgtg
gtggatcgagtggaggctgaggatgggacctatgatgtcatcttcctagggactgattcg
ggttctgtgctcaaagtcattgccctccagggtggtggcttgactgaacctgaagaggtg
gttttggaggagctccaggtgtttaaggtgccaacgcccatcactgagatggagatctct
gtcaaaaggcaaacgctgtatgtgggctctccactgggtgtggcccggctgcagctgcac
cagtgtgagacttacggcagtgcctgtgctgagtgctgcctggcccgggacccatactgt
gcttgggatggcactgcctgtgcccgctaccgccccagctctggcaagcgcaggttccgt
cggcaggacatacgccatggcaaccctgctgtgcagtgtctgggccagggccagagccaa
aacaaagcagcttcggggctcatgaccagagtctttggcacagagcacaacagcaccttc
cttgagtgcctgcccaagtctcctcaggctgcagtgcgctggttcttacaaaggccaggg
gataaggggactgaccaggtgaagacagatgagagagttgtgcagacggcccaagggctg
ctgttccgaaggctcagccgccatgacgcaggaaactacacttgcaccactctggaacat
ggcttctcccagaccgtggtccgttttgccctggaggtgattgcagctgtgcaactggac
agcctgttccttcgggagtcaaggctagaggagccctcagcctggggaagcctggcctct
gcctcccccaagacttggtataaggacatccttcagctcacgggcttcgccaacctgccc
cgtgtggatgagtactgtgaacgtgtatggtgcaggggtgtcggggagcgctcaggctcc
ttccgcggaaagggaaagcaagcgaagggcaagagctgggcagggctggaactgggcaag
aagatgaagagcagggtgctggctgagcacaatcggacaccccgggaggtagaagccaca
tag

DBGET integrated database retrieval system