KEGG   Mus musculus (mouse): 218877Help
Entry
218877            CDS       T01002                                 

Gene name
Sema3g, AK129018
Definition
(RefSeq) sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3G
  KO
K06840  semaphorin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    218877 (Sema3g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema ig Ig_3 PSI Ig_6 I-set Ig_2
Motif
Other DBs
NCBI-GeneID: 218877
NCBI-ProteinID: NP_001020550
MGI: 3041242
Ensembl: ENSMUSG00000021904
Vega: OTTMUSG00000015259
UniProt: Q4LFA9
Position
14; 14 B
AA seq 780 aa AA seqDB search
MDPSAWAICCLLGSLLFHVGIPSPGPSPSVPRLRLSYRDLLSTNRSAIFLGPRGSLDLQV
MYLDEYRDRLFLGSRDALYSLRLDQAWPDPREVLWLPQPGQKVECVRKGKDPLTECANFV
RVLQPHNRTHLLACGTGAFQPICTFITVGHRGEHVLRLDASSVENGRGRCPHEPSRPFAS
TFVGGELYTGLTADFLGREAMIFRSGGPRPALRSDSDQSLLHEPRFVMAARIPDNSDRDD
DKVYFFFSETVPSPDGGPGHVTISRVGRVCVNDAGGQRVLVNKWSTFLKARLVCSVPGPG
GAETHFDQLEDVFLLWPKAGKSLEVYALFSTVSAVFQGFAVCVYHMVDIWEVFNGPFAHR
DGPQHQWGPYGGKVPFPRPGVCPSKMTAQPGRPFGSTKDYPDEVLQFVRDHPLMFQPVRP
RRGRPVLVKTHLAQRLRQIVVDRVEAEDGTYDVIFLGTDSGSVLKVIALQGGGLTEPEEV
VLEELQVFKVPTPITEMEISVKRQTLYVGSPLGVARLQLHQCETYGSACAECCLARDPYC
AWDGTACARYRPSSGKRRFRRQDIRHGNPAVQCLGQGQSQNKAASGLMTRVFGTEHNSTF
LECLPKSPQAAVRWFLQRPGDKGTDQVKTDERVVQTAQGLLFRRLSRHDAGNYTCTTLEH
GFSQTVVRFALEVIAAVQLDSLFLRESRLEEPSAWGSLASASPKTWYKDILQLTGFANLP
RVDEYCERVWCRGVGERSGSFRGKGKQAKGKSWAGLELGKKMKSRVLAEHNRTPREVEAT
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggacccatctgcgtgggccatctgctgcctcctggggagccttctgttccatgtgggc
atccccagccctggtcccagccccagtgtgcctcgtctgcggctctcctacagagatctc
ctgtctaccaaccgctctgccatctttctgggcccacggggttccctagacctccaagtc
atgtacctggatgagtatcgagatcgcctctttctgggaagccgagatgccctttactct
ctgagactggatcaggcatggccagacccccgggaggtcttgtggctgccacagccagga
cagaaggtggaatgtgtccgcaagggaaaagaccctttgacggagtgtgccaacttcgtg
cgggtcttacaaccccataaccggacccatctgctggcctgtggcacaggagccttccaa
cccatctgcaccttcatcacagtggggcatcgaggggagcatgtgctccgcttggatgct
agcagcgtcgagaatggaagggggcgttgcccacatgagcccagccgacccttcgccagc
acctttgtaggtggggagctatacacaggtctcactgccgatttcctgggacgtgaggcc
atgattttccggagtgggggtccccgaccagccctgcgttctgactctgaccagagcctc
ctacatgaaccccggtttgtgatggctgctcggatcccagataactctgaccgggacgac
gacaaggtgtacttcttcttctccgagactgtcccgtcaccagatggtggcccaggtcat
gtcaccatcagccgagtgggccgcgtctgtgtgaatgatgctggtggccagcgggtgctg
gtgaacaaatggagcactttcctcaaggcccggctggtgtgctctgtgcctggcccgggt
ggggctgagactcactttgaccagctagaggatgtgttcctgctgtggcccaaggccggg
aagagcctcgaggtgtatgcgctgttcagcactgtcagtgctgtgttccagggctttgct
gtctgtgtgtaccacatggtagacatctgggaggtcttcaatgggccctttgcccaccga
gatggccctcagcatcagtggggaccctatgggggcaaggtgcccttccctcgccccggt
gtgtgtcctagcaagatgaccgcacagccaggccgaccctttggcagcaccaaggactac
ccagacgaggtgttgcagtttgtccgagaccacccactcatgttccagcctgtgaggcct
cggcgtggccgccctgtcctggtcaaaactcacttggctcagcgactgcgccagattgtg
gtggatcgagtggaggctgaggatgggacctatgatgtcatcttcctagggactgattcg
ggttctgtgctcaaagtcattgccctccagggtggtggcttgactgaacctgaagaggtg
gttttggaggagctccaggtgtttaaggtgccaacgcccatcactgagatggagatctct
gtcaaaaggcaaacgctgtatgtgggctctccactgggtgtggcccggctgcagctgcac
cagtgtgagacttacggcagtgcctgtgctgagtgctgcctggcccgggacccatactgt
gcttgggatggcactgcctgtgcccgctaccgccccagctctggcaagcgcaggttccgt
cggcaggacatacgccatggcaaccctgctgtgcagtgtctgggccagggccagagccaa
aacaaagcagcttcggggctcatgaccagagtctttggcacagagcacaacagcaccttc
cttgagtgcctgcccaagtctcctcaggctgcagtgcgctggttcttacaaaggccaggg
gataaggggactgaccaggtgaagacagatgagagagttgtgcagacggcccaagggctg
ctgttccgaaggctcagccgccatgacgcaggaaactacacttgcaccactctggaacat
ggcttctcccagaccgtggtccgttttgccctggaggtgattgcagctgtgcaactggac
agcctgttccttcgggagtcaaggctagaggagccctcagcctggggaagcctggcctct
gcctcccccaagacttggtataaggacatccttcagctcacgggcttcgccaacctgccc
cgtgtggatgagtactgtgaacgtgtatggtgcaggggtgtcggggagcgctcaggctcc
ttccgcggaaagggaaagcaagcgaagggcaagagctgggcagggctggaactgggcaag
aagatgaagagcagggtgctggctgagcacaatcggacaccccgggaggtagaagccaca
tag

DBGET integrated database retrieval system