KEGG   Mus musculus (mouse): 21888
Entry
21888             CDS       T01002                                 

Symbol
Tle4, 5730411M05Rik, AA792082, Bce-1, Bce1, ESTM13, ESTM14, Grg4, X83332, X83333, grg-4
Name
(RefSeq) transducin-like enhancer of split 4
  KO
K04497  groucho
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21888 (Tle4)
   04330 Notch signaling pathway
    21888 (Tle4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    21888 (Tle4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     SCMC complex
      21888 (Tle4)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 NBCH_WD40 HALZ DUF4662
Other DBs
NCBI-GeneID: 21888
NCBI-ProteinID: NP_035730
MGI: 104633
Ensembl: ENSMUSG00000024642
UniProt: Q62441 Q3UY41
Position
19 A; 19 9.11 cM
AA seq 773 aa
MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEK
TEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQV
TMAELNAIIGQQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQS
HLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGSEKHRNSTDYSSESKKQKTEEKEIA
ARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISPASVASSS
STPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSL
RTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP
VVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQ
INTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCR
LLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGN
IAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFT
SQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCGKWFVSTG
KDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgattcgcgacctgagcaagatgtacccgcagacgcgccacccggcaccgcatcagcct
gctcaacccttcaaatttacaatttcagaatcctgtgatcggattaaggaagagtttcag
tttttacaggctcaataccacagtctgaagctggaatgtgagaagctcgccagcgagaag
acagagatgcagcggcattatgtcatgtattatgaaatgtcctatgggttgaacatagaa
atgcacaagcaggcagagattgttaaacgactaaatgctatctgtgcacaggtcattcct
ttcctgtcccaagagcaccagcaacaagtggtgcaggctgtggaacgggccaagcaggtg
accatggcagaactgaacgccatcattgggcaacaactccaagctcagcatttatcacat
ggacatggtctgcctgtgcctctgacaccacacccttcagggcttcagcccccagccatc
ccacctatcggtagcagtgcaggacttctggccctctccagtgcactaggaggtcagtct
cacctcccaattaaggatgagaagaagcaccatgacaatgatcaccaaagagacagagac
tccatcaagagctcttccgtatccccatcagccagtttccggggttctgagaaacatagg
aactctacagactattcctcagagagcaaaaagcagaaaacagaagaaaaagaaattgca
gctcgctatgacagtgatggtgagaagagtgatgacaacttggtagttgatgtgtccaat
gaggatccatcttccccccgaggaagcccagcacattccccaagggagaatggcctggac
aagacacgactcctcaagaaagatgcccccatcagccccgcttctgttgcatcttccagc
agtactccttcctccaaatccaaagagcttagccttaatgaaaagtctactactcctgtt
tcaaagtccaatacccctactccacgaactgatgcacctacccctggcagtaattctact
cctggactgaggcctgtacctggaaagccaccaggtgtggaccccttagcatcaagcctg
aggaccccgatggctgtaccttgtccatatccaaccccctttgggatcgtgccccatgct
gggatgaacggagagctgaccagccccggagccgcctatgctgggctacacaacatctcc
ccccagatgagtgcagctgctgctgcagctgcggcagcagcagcctatggaagatcacct
gtggtgggatttgatccacaccatcacatgcgagtgccagcaatacctccaaatctaaca
ggcattccaggaggaaaaccagcatactcctttcacgtcagtgccgatggccagatgcag
cctgtccctttcccccctgatgccctcattggaccagggatcccccgacacgctcgacag
atcaacaccctcaaccatggggaggtggtgtgtgcagtgaccatcagcaaccccacaagg
cacgtgtacacaggtggcaagggctgtgttaaggtctgggacatcagccaccctggcaac
aagagcccagtctctcagctggactgtctgaacagggataactacatccgttcctgcaga
ttgctccctgatggtcgcaccttaattgttggaggggaagccagcacactgtccatctgg
gacctggcagctccaactccacgcatcaaggcagagctgacatcctcagcccctgcctgc
tatgctctggccatcagccccgactccaaggtctgcttctcatgctgcagcgacggtaac
atcgcagtgtgggatctgcacaaccagactctggtgaggcaattccaggggcacacagat
ggagccagctgtattgacatttctaatgatggcaccaagctctggacaggtggtttggac
aacactgtgaggtcctgggacctgcgtgaagggcggcagctgcagcaacatgacttcacc
tctcagatcttttcattgggctattgcccaactggagagtggcttgcagtggggatggag
aatagcaatgtggaagtattgcatgtcaccaaaccagacaaataccagttgcatcttcat
gagagctgtgtgctgtcactcaagtttgcccactgtggcaaatggtttgtaagcactgga
aaggacaaccttctgaatgcttggaggacgccttatggggccagcatattccagtccaaa
gaatcctcatcggtgcttagctgtgacatctctgtggatgacaagtacattgtcactggc
tctggggacaagaaagctacggtttatgaagttatttattaa

DBGET integrated database retrieval system