KEGG   Mus musculus (mouse): 21894
Entry
21894             CDS       T01002                                 

Gene name
Tln1, Tln
Definition
(RefSeq) talin 1
  KO
K06271  talin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    21894 (Tln1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21894 (Tln1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    21894 (Tln1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    21894 (Tln1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21894 (Tln1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   21894 (Tln1)
  Exosomal proteins of other cancer cells
   21894 (Tln1)
SSDB
Motif
Pfam: VBS I_LWEQ Talin_middle FERM_f0 FERM_M FERM_N ACBP IRS DUF1013 GIT1_C DUF3025 ADH_zinc_N_2 RA
Other DBs
NCBI-GeneID: 21894
NCBI-ProteinID: NP_035732
MGI: 1099832
Ensembl: ENSMUSG00000028465
Vega: OTTMUSG00000006961
UniProt: P26039 Q3UHS6 Q80TM2 Q0V930
Structure
PDB: 

Position
4; 4 A5
AA seq 2541 aa
MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEIKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAKLLGEIAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPASPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRQLETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGDPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRV
QELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEH
NT seq 7626 nt   +upstreamnt  +downstreamnt
atggttgcgctttcgctgaagattagcattgggaatgtggtgaagacgatgcaatttgag
ccatctaccatggtgtacgacgcctgccgcatgattcgtgagcggatcccagaggccctg
gctggccctcccaacgactttgggctctttctgtcagatgatgaccccaaaaaaggcatc
tggctagaggctgggaaagctttggactactacatgctccgaaatggggacaccatggag
tacagaaaaaagcagagacccctgaagatccggatgttagacggaacggtgaagactatc
atggtggatgactccaagaccgtcacagacatgctcatgaccatttgtgcccgaattggt
atcaccaaccatgatgagtattcactggttcgagagctgatggaagaaaagaaagatgag
gggacagggaccctgagaaaagacaagaccctactgcgagatgaaaagaagatggagaag
ctaaagcagaagttgcacacagacgatgagttgaactggctggaccatgggcggacactg
agggaacagggagtggaagagcatgagacgttgctgctgcggagaaagttcttctactca
gaccagaatgtggattcccgagaccctgtacagctgaaccttctctatgtgcaggcacga
gatgacatcctgaatggctcccatcctgtctcctttgacaaggcctgtgaatttgcaggc
ttccagtgccagatccagtttggacctcacaatgaacagaagcacaaggctggcttcctt
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttt
caggcacacaagaattgtgggcagatgagtgaaattgaggccaaggtacgctacgtgaag
ctggcccgttccctcaagacttacggtgtctccttcttcctagtcaaggaaaagatgaag
gggaagaataaactggtgcccaggctgttgggcatcactaaggagtgtgtgatgcgtgtg
gatgagaagaccaaggaggtgattcaggaatggagcctcaccaacatcaaacgctgggct
gcctctcccaagagctttactctggactttggagactatcaggatggctactactcagta
cagacgacagaaggcgagcagatcgcacagctcattgctggctacatagatatcatcctt
aagaagaaaaaaagcaaggaccattttgggctggagggagatgaagagtctactatgttg
gaggactcagtgtcacccaaaaagtcaacagtccttcagcagcagtacaaccgagtgggg
aaagtggagcacggctctgtggctctgccagccatcatgcgctctggagcctctggtcct
gagaatttccaggtggggagcatgccacctgcccagcagcagatcaccagtggccagatg
caccgaggacacatgccacctctgacttcagcccagcaggcgctcactggaaccattaac
tccagcatgcaggctgtgcaggctgcccaggccactctggatgactttgagactctaccc
cctcttggccaggatgctgcctccaaagcttggcgtaagaacaagatggatgaatcaaag
catgagatccactcccaggtagatgccatcacagctggcactgcctctgtggtaaacctg
acagcaggagatcctgcagagacagactatacagcagtgggctgtgcagtcaccaccatc
tcttccaacctgacggagatgtcccgtggggtgaagctattggctgccctgctggaggat
gaaggcggcaatggccggccccttctgcaagcagcaaagggccttgcaggggctgtgtcg
gaactgcttcgcagtgctcagcccgccagcgctgagccccgtcagaacctgctgcaggca
gccgggaacgtgggccaggccagtggggagctgttgcagcaaattggggaaagtgacact
gacccccacttccaggatgttctaatgcagctagcaaaggcagtggcaagtgctgcagcc
gccctggtcctcaaggccaagagtgtggcccagcgcacagaggattccgggcttcagacc
caagtgattgctgcagctacgcaatgtgctctgtccacttcccagctggtggcctgtacc
aaggtggtagcacctacaatcagctcacctgtgtgccaagaacagctagtcgaggctggg
cgactggtggccaaagctgtggagggctgtgtgtctgcctcgcaagcagctacagaagat
ggacagctgcttcgaggggtaggagcagcagccacggctgtcacccaggccctcaatgag
ctgctgcagcacgtgaaggcccacgccaccggagctgggcctgccggtcggtatgaccaa
gccactgataccatcctcaccgtcactgaaaacatcttcagctccatgggtgatgctggg
gagatggtgcgccaggcccgcatcctggcccaagccacctcagacctggtcaatgctatc
aaggccgatgctgagggggagagtgatctggagaactctagaaagctcctgagtgctgcc
aagatcctcgctgatgccaccgccaagatggtggaggcggccaagggagcagccgcccac
cctgacagtgaggaacagcagcagcgactgcgtgaagcagctgaggggcttcgcatggcc
accaatgcagctgcgcagaacgccatcaagaagaagttggtgcagcgcctggagcatgca
gccaagcaagctgcagcctctgcaacacagaccattgctgcagcccaacatgcagcctct
gcccccaaggcctctgcgggcccccagcccctactggtgcagagctgtaaggccgtggca
gagcagattccgttgctggtgcagggtgtccgaggaagtcaagctcagcctgacagccct
agtgctcagctcgccctcattgctgccagccagagcttcctgcagccaggtgggaagatg
gtggcagcggcaaaagcctcagtgccaacaattcaggaccaggcttcagcaatgcagctg
agtcagtgcgcaaagaacctaggcactgccctggccgagctgcgcactgctgctcagaag
gctcaggaggcatgtggacctttggagatggattctgcactgagtgttgtacaaaatcta
gagaaagacctacaggaaataaaagcagcagctcgagatggcaagcttaagcccttaccc
ggggaaacaatggagaagtgtacccaagatcttggcaacagcaccaaagcggtgagctct
gccatcgccaagctgctgggggagattgcccagggcaatgagaactatgcaggtattgca
gctcgggatgtagctggtggactaaggtcactagcccaggctgcgcggggtgtggctgcg
ctgacatcagatcctgcagtgcaggccattgtgcttgacacagccagcgacgttctggac
aaggccagcagcctcattgaagaggcaaaaaaagcatctggacacccaggggacccagaa
agccagcaaaggcttgctcaggtagctaaagcagtgacccaagccctgaaccgctgtgtc
agctgcctgcctggccaaagagacgtggataatgccctacgagccgttggagatgccagc
aagcgactcctgagtgactcgcttcctccaagcacggggacatttcaagaagcacagagc
cgattgaatgaagctgcagctgggttaaatcaggccgccacagaactggtgcaagcctcc
cgaggaactcctcaggacctggctcgggcctccggccgatttggacaggacttcagcacc
ttcctggaagctggtgtggagatggccggacaggccccgagccaggaggaccgagcccag
gtggtgtccaacctgaagggcatatccatgtcttcaagcaaacttctccttgccgctaag
gccttgtccacagaccctgcttctcccaacctcaagagtcagctggctgcggctgcccgg
gcagtgacggacagcatcaaccagctcatcaccatgtgcacccagcaggcacctggccag
aaggagtgtgacaatgcacttcggcagctagagacagtccgagaactcctggagaatcca
gtccagcccatcaacgacatgtcctacttcggttgcttggacagtgtcatggagaactcc
aaggtcctaggtgaggccatgactggcatctcccaaaatgccaagaatggaaatctgccg
gagtttggagatgccattgccacagcctccaaggctctctgtggcttcacggaggcagcc
gcacaggcagcatatctagttggtgtctctgaccccaacagccaagctggacagcaagga
ctggtggaacccacacagtttgcccgtgcaaaccaggcaattcagatggcctgtcagagt
ctgggggagcctggctgtacccaggcccaggtgttatctgcagccactattgtagccaaa
cacacatctgcattgtgtaacagctgtcgcctggcttccgctaggactgccaatcccact
gccaagcgccagtttgtacagtcagccaaggaggtggccaacagtacagccaatcttgtc
aagaccatcaaggcactagatggggacttcacagaagagaaccgtgcccagtgccgagca
gccacagcccctctgctggaagctgtggataacctgagtgcctttgcctccaaccctgag
ttctccagcgtccctgcccagatcagccctgagggcagagcagccatggagcccattgta
atctctgctaagacaatgttggagagtgctggagggctcatccagacagctcgggcgtta
gcagtcaatccccgagaccccccacgttggtctgtgctagctggccactctcggactgtc
tcagattccatcaagaaacttattacaagcatgagggacaaagccccagggcagctggag
tgtgagacagccattgcggctctgaacagctgcttgcgggacctagatcaggcttcgctt
gccgctgtcagccagcagcttgctccccgtgaaggaatctctcaagaggctttgcacacc
cagatgctcactgcagtgcaagaaatttctcatctcattgagccgctggccagcgctgct
cgggctgaagcctcccagctgggacacaaggtgtcccaaatggcccagtactttgaacca
ctcaccctggctgcagtgggtgctgcgtctaagaccctgagccacccacagcagatggca
cttctggaccagactaaaacgttggcagagtctgccttgcagttgctatatactgccaag
gaggctggtggtaaccccaagcaagcagcacacacccaggaagccctggaggaggctgtg
cagatgatgacagaggccgtagaagacctgacgacgaccctcaacgaagcagccagtgct
gcaggagtcgttggcggcatggtggactctatcactcaggccatcaaccagctagatgaa
ggacctatgggtgacccagaaggctcattcgtagattaccagacaaccatggtgaggaca
gccaaggccattgctgtcactgttcaggagatggtaaccaagtcaaacaccagccctgaa
gagctaggccctcttgccaaccagctgaccagtgactatggccgactggcctcacaagcc
aagcctgcagctgtggctgctgaaaatgaagagataggcgctcacatcaaacaccgagta
caggagctgggccatggctgctctgctctggtcaccaaggcaggtgccttgcagtgtagc
cccagtgatgtctacaccaagaaggagctcatagagtgtgcccgcagagtgtcagagaag
gtctcccatgttctggctgcactccaggctgggaatcgtggtacccaggcctgcattaca
gcagccagtgctgtgtctggtatcattgctgacctcgacaccaccatcatgttcgctact
gctggcacacttaaccgtgagggtgctgaaacttttgctgaccaccgggagggtatctta
aagacagcaaaggttcttgtggaggacaccaaggtcctagtgcagaatgcagctgggagc
caggagaagttggcacaagccgcccagtcctccgtggccaccattacccgcctcgctgat
gtggtcaagctcggtgcagccagcctaggagccgaagaccctgaaactcaggtggtgctg
atcaatgcagtaaaggacgtagccaaggccctgggtgacctcatcagcgctacgaaggct
gcagcgggcaaagttggggatgaccctgcagtgtggcagctcaagaactctgccaaggtg
atggtgaccaatgtgacatcattgctcaagacagtgaaggctgtggaagatgaggccacc
aaaggcacacgggccctagaggcaaccacagagcacatacgtcaggaactggcggtcttc
tgttccccagagccacctgccaagacctctacccctgaagacttcatccgaatgaccaag
ggtattactatggcaacagccaaagccgttgctgctggcaattcctgtcgacaggaagat
gtcattgccacagccaatctgagccgacgggctattgcggacatgcttcgggcttgcaag
gaagcagctttccacccagaagtggcgcctgatgtacggctccgagccctgcactatggc
cgggagtgtgccaatggttacctggaactgctggaccacgtgctgctgacccttcagaag
ccaaacccagacctgaagcagcagctaactggacactcaaagcgggttgctggctctgtg
actgagctcatccaggctgctgaagccatgaaaggaacagagtgggtggacccagaggac
cctactgtcattgctgagaatgaactcttgggagccgcagccgccatcgaggctgcagcc
aagaagctggagcagctgaagcccagggccaaacccaaggaggcggatgagtccttgaac
tttgaggaacaaatcctagaagctgccaagtccatcgctgcagccaccagtgcactggta
aaggctgcgtcagcagcccagagggagctggtggctcaaggaaaggtgggcgccattcca
gccaatgcactggatgatgggcagtggtcgcagggcctcatttccgctgcccgtatggtg
gctgcggccaccaacaatctgtgtgaagcagctaacgcagctgtccagggccatgctagc
caggagaaactcatttcctcagccaagcaagtagctgcctccacagctcagctcctggta
gcttgcaaggtcaaagcagatcaggactctgaggcaatgaaacggctccaggctgctggc
aatgcagtgaagagggcctcagataacctggtaaaggcggcccagaaagctgcagccttc
gaagaccaggagaatgagacggtggtggtgaaggagaaaatggttgggggcattgcccag
attatcgcagcacaggaagagatgcttcggaaggaacgagagctggaagaggctcggaaa
aagctcgcccagatccggcagcagcagtacaagttcttgccttcagagcttcgagacgag
cactaa

KEGG   Mus musculus (mouse): 70549
Entry
70549             CDS       T01002                                 

Gene name
Tln2, 5730421P04Rik, AI507121, AI787438, AL118320, mKIAA0320
Definition
(RefSeq) talin 2
  KO
K06271  talin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    70549 (Tln2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    70549 (Tln2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    70549 (Tln2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    70549 (Tln2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    70549 (Tln2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   70549 (Tln2)
  Exosomal proteins of other cancer cells
   70549 (Tln2)
SSDB
Motif
Pfam: VBS I_LWEQ Talin_middle FERM_f0 FERM_M FERM_N IRS ACBP GIT1_C
Other DBs
NCBI-GeneID: 70549
NCBI-ProteinID: NP_001074711
MGI: 1917799
Ensembl: ENSMUSG00000052698
Vega: OTTMUSG00000062653
UniProt: Q71LX4 Q8CDM9 E9PUM4 Q68FD6 Q3TN69
Structure
PDB: 
3G9W

Position
9; 9 C
AA seq 2542 aa
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATSDSELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPSAQQQLVQSCKA
VADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAAESQLKP
LPGETLEKCAQDLGSTSKGVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTNDPEAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDTESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGEASKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLIMLCTQQAPGQKECDNALRELETVKGMLE
NPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKC
RIATTPLIEAVENLTAFASNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA
SLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK
YSKAIAVTAQEMMTKSVTNPEELGGLASQMTTDYGHLALQGQMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACI
TAATAVSGIIADLDTTIMFATAGTLNAENGETFADHRENILKTAKALVEDTKLLVSGAAS
TPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDPETQVVLINAIKDVAKALSDLIGATK
GAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTV
FQSKDIPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLIAC
KQASFYPDVSEEVRTRALRYGTECTLGYLDLLEHVLVILQKPTPELKHQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAA
GNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG
NT seq 7629 nt   +upstreamnt  +downstreamnt
atggtggccctatccttaaagatctgtgtccgccactgcaatgtggtgaagaccatgcag
tttgagccatctacagctgtgtatgacgcttgtcgagtcattagggagagagtacctgag
gcacagactgggcaagcttctgactatgggctgtttctctccgatgaagacccaaggaaa
gggatttggctagaagcaggtcggacactggattactacatgttgcggaatggggacatt
ctggagtacaagaagaaacagaggcctcagaaaatccgaatgttggatggctctgtgaag
acggtgatggtagatgactccaagacggtgggggagctcctggtcacgatctgcagcagg
ataggaataacaaattatgaagaatactctttaatccaagaaaccattgaagaaaagaaa
gaagaagggacaggcacactaaaaaaagataggacgttgttacgagatgagaggaagatg
gagaagctgaaggccaaactgcacacagatgatgacttaaattggctagatcacagccgg
acattcagagagcaaggcgtggatgaaaatgaaacattgttgctccgacggaagttcttt
tactctgatcagaatgtggactcgagagacccggtgcagttgaacttgctttatgtccag
gctcgggatgacatcctgaatggctctcaccctgtctccttcgagaaggcctgtgagttt
ggtgggttccaagcccagatacagtttggacctcacgtggaacacaaacacaagcctgga
ttcttagatctaaaggagttcctgccaaaagagtacatcaagcagagaggagccgagaag
cgaatatttcaggaacataaaaactgtggagagatgagtgaaatagaagccaaggtgaag
tacgtcaaactcgcccggtccctccggacatatggggtgtcctttttcctagtgaaggaa
aaaatgaaaggcaagaacaagttggttccccgtctcctgggcatcaccaaggactccgtc
atgcgtgtggatgagaagaccaaggaggtgcttcaggagtggcctctcaccacggtcaag
cgctgggccgcttcacccaagagcttcacactggattttggggagtaccaagagagctac
tattcagtacaaaccacagagggggagcaaatatcccagctgattgcaggatacattgat
atcatcctcaaaaagaaacaaagcaaagatagatttggcctggaaggggatgaggagtca
actatgttggaagaatcagtttccccaaaaaaatctaccatcctgcagcagcagttcaac
cggactgggaaagcagagcatggttcggtagcactgccagctgtcatgcgctctggctcc
agtgggcctgagacgttcaatgttggcagcatgccgtcaccacagcagcaggtcatggtc
ggacagatgcaccgaggacacatgcctccgctgacgtcggcacagcaagcccttatgggg
accatcaacacaagcatgcacgctgtccagcaggctcaggatgacctcagcgagctcgac
tcgctgccacccctcggccaagatatggcatctagggtatgggttcagaacaaagtggat
gaatccaagcatgaaatccactctcaagtcgatgctatcacagctgggacagcttcagtt
gtcaacctcacagctggtgaccctgcagacactgactacacagccgtgggctgtgcaatc
actaccatttcttccaacctgaccgaaatgtccaagggggtcaagctgctggcagccctc
atggacgatgacgtgggcagtggggaggatcttctcagagctgccaggaccctcgccggg
gctgtgtctgatttgctgaaggctgtgcagcctacttcaggagagcctcgacagactgtt
ttgactgctgccggaagcatcggccaagccagtggagatctcctcagacagattggagag
aacgagacggatgagagattccaagatgttttaatgagtctagctaaggctgttgccaat
gctgctgccatgttagtactgaaggcgaagaatgtggcccaggtggctgaagacaccgtc
ctacagaacagggtgatcgccgcagccacccagtgtgccctctctacctcgcagcttgtg
gcgtgtgctaaggtggtgagccccaccatcagctctcccgtgtgccaggagcagctgatc
gaagctgggaagctggtggaccgctctgtggaaaactgtgtccgagcctgccaggcggcc
accagtgatagcgagctcctgaagcaggtcagcgcggcggccagtgtggtcagccaggcc
ctgcacgacctcctgcagcatgtgcggcagttcgccagccgaggcgagcccattggccgc
tatgaccaggccaccgacaccatcatgtgtgtcactgagagcatcttcagttccatgggc
gatgctggtgagatggtgcgccaagcccgggtgctagcccaggccacatcagatctcgtc
aatgccatgaggtcagatgcggaggctgagattgacatggagaattccaagaagctcctg
gcggccgcaaagctcttggctgactccactgcccgcatggtggaagctgcgaagggggct
gcagccaacccagagaatgaagaccagcagcagaggctgagagaagctgccgagggtctc
cgagtagcaaccaatgccgctgcgcagaatgctattaagaaaaaaatcgtcaaccggctg
gaggttgcagccaagcaggctgcagctgctgccacacagaccatcgcagcctcccagaat
gcagccatctccaacaagaacccctcagcccagcaacaactggtccagagctgcaaggcg
gtggctgatcacatccctcagctagtgcagggcgtgagagggagccaagcacaagcagaa
gacctcagtgcccagctggctctcatcatctccagccagaacttcctgcagcctggaagc
aagatggtgtcctctgctaaggcggcggtgcccactgtgagtgaccaggctgcagccatg
cagttgagtcagtgtgccaagaacctggcaaccagcctggccgagctgcgcacagcctcg
cagaaggcccacgaagcctgtggccccatggaaatagattctgcactgaacactgtgcag
actctcaagaatgagctgcaggacgccaagatggccgctgcagaaagtcaactgaaacca
cttccaggagaaacgctggaaaagtgtgctcaggacctgggaagcacctctaagggagtg
ggctcctccatggcacagctcctgacctgtgctgctcaaggcaatgagcattacacaggc
gtggcagcaagagaaacagcccaggccctgaaaacactggcccaggctgcccggggagtg
gcggcatccacaaatgatcctgaggctgctcatgccatgttagactctgctcgggatgtg
atggagggctctgccatgctcatccaggaagccaagcaggcactaattgcacctggagac
acagagagtcagcagagattagcccaggtggccaaagctgtgtctcactcactgaataac
tgcgtgaattgccttcctggacagaaggatgtggatgtcgccttgaagagcatcggggag
gccagcaagaagctacttgtagattcgctacctccaagcacaaagcccttccaggaggcc
cagagtgagctgaaccaggctgctgctgatctgaaccaatctgctggggaagtcgtccat
gccacaaggggccagagtggagagctggcagccgcttctggaaaattcagtgatgacttt
gacgagttcctggatgccggcattgagatggctggccaggcacagacaaaagaagaccag
atgcaagtgatagggaacctgaagaatatctcgatggcgtccagcaagctcctgctggcc
gccaagtctctctctgtagatcctggagctcccaacgcaaaaaatctcctggctgcagct
gcaagagctgtgacagagagcatcaatcagctcatcatgctgtgtactcagcaggcccct
gggcagaaggagtgtgacaacgccctgcgtgagctcgagactgtcaaggggatgttggaa
aacccgaatgagcctgtgagcgacctctcttattttgactgcattgagagtgtgatggag
aactccaaggttctgggcgagtcaatggcagggatttcacagaatgccaagactggagac
ctccctgccttcggagaatgtgtggggattgcatctaaggctctctgtgggctgacagag
gcagcagcccaggctgcgtatctggttggcatctctgatccgaacagccaggcaggtcac
caaggcctggtggaccccatccagtttgccagggctaaccaggcgatccagatggcatgt
cagaacttggtggaccctggcagcagcccatcacaggttctgtcggctgccactattgtt
gccaagcacacatcagccttatgcaatgcctgccgcatcgcctcatccaagacggccaac
cctgttgccaagcggcactttgtccagtcagccaaggaggttgccaacagcaccgccaac
ctggtcaagaccatcaaggccctggatggggatttctctgaagacaatcgcaataagtgt
cgaattgctaccacgcccttgatcgaggcggtggagaacctaacagcgtttgcatcaaac
cccgagtttgccagcattcctgcacagatcagctctgagggctcccaggcgcaggaacca
atcttggtctcagccaagaccatgctggagagctcatcgtacctcatccgcaccgcgcgc
tctctggccatcaaccccaaagatccgcccacctggtccgtgttggctggacactcccac
actgtgtctgactccattaagagtctcatcacgtctatcagggacaaagccccagggcag
agggaatgtgactactccattgatggcatcaaccggtgcatcagggacatcgagcaggcc
tccctggccgcggtcagccagagcctggccacgagggatgacatctctgtggaggcccta
caggagcagctgacctcagtggtccaagaaatcggacatcttattgatcccattgccaca
gctgcccgaggagaagctgcccaacttggacataaggtgacacagctggcgagctacttt
gagcccttgatcttagctgcagttggtgtcgcctccaagatgctggaccatcaacaacag
atgacagtgctggaccagaccaagactcttgcagagtctgccctgcagatgctgtatgca
gccaaggaaggtggaggtaaccccaaggcacagcacacccacgacgccatcacagaggct
gcgcagctgatgaaggaagctgtggatgacatcatggtgacactgaatgaagcagccagt
gaggtgggactggtgggaggcatggtggacgccatcgcagaggctatgagcaagctggat
gaaggcacacctccagaaccaaagggaacgtttgttgactaccagacgactgtggttaaa
tactccaaagccattgccgtcacagctcaggaaatgatgactaagtcggttactaacccg
gaggagttgggaggcctggcttcacaaatgaccactgactatgggcacctggctctccag
ggccagatggcagcagccaccgccgaaccagaggagattggattccagattcgcacacgt
gtgcaggaccttggccatggctgtatcttcctggtgcaaaaggcaggagccctccaggtg
tgccccacagacagctacaccaagagggagctgatcgagtgtgcccgctctgtcactgag
aaggtgtccttggtgctgtctgctctccaggctggaaacaaggggacccaggcatgcatc
acggccgcaactgcagtttctgggatcattgccgatctggacaccaccattatgtttgca
acagctggcacactgaatgcagagaacggcgagacctttgccgatcacagggagaacatt
ctgaagacagccaaggccttggtggaagacacaaagctcctcgtgtctggggctgcatcc
actccagacaagctggcccaggccgctcagtcctcagcagccaccatcacccagctggca
gaggtggtcaagctgggggccgccagcctgggctccaatgaccctgagacccaggtggta
ctgataaatgccatcaaagacgtggccaaggccctttccgatctcattggtgctaccaag
ggagctgccagcaagccggctgacgacccctccatgtaccagctcaaaggagccgccaag
gtgatggtgaccaatgtcacctcccttcttaagactgtgaaggcagtggaagacgaggcc
acccggggcacaagggcacttgaggccaccatcgagtacataaaacaggagctcacagtg
ttccagtcaaaagacatacctgaaaagacatcatcacccgaggaatcaataagaatgacg
aaaggtatcaccatggcaacagcgaaagccgtggcagctgggaactcatgtagacaagag
gatgtaattgcaaccgccaatctgagcaggaaggctgtctcagatatgttgatagcttgc
aagcaagcatccttctaccctgatgtcagtgaagaggtgcgaaccagagccttgcggtat
ggcacagaatgcaccttgggctacctggacctactagaacacgtcttggtgatccttcaa
aagccaaccccggaactcaagcatcagctggctgctttctccaagagagttgctggagct
gtgacggagctcatccaggcagcggaagccatgaaaggaacagagtgggtggatccagaa
gacccaaccgtcattgcagaaactgagttactgggagctgcagcatccattgaagccgct
gccaagaagttagagcagctgaagccaagagcaaagccaaagcaagcagacgagaccctg
gattttgaagaacagatcttagaagctgctaaatccattgctgctgccacaagtgccctg
gtcaaatcggcctcagcagcccagagggagctggtagcccaaggcaaggtgggctccatc
cctgccaatgctgccgatgatggacagtggtcccaggggctgatctctgccgcccggatg
gtggcggcagcaaccagcagtctctgtgaggcagccaatgcctctgtgcagggacatgcc
agtgaggaaaagctcatctcatccgccaagcaggtcgcagcttcaaccgctcagctgctg
gtggcctgcaaggtgaaggccgaccaggattcagaggccatgaagcggctacaggcggca
ggaaatgctgtgaaaagagcctcagacaatcttgttcgtgcagcccagaaggcagcattt
ggcaaagctgatgatgacgatgttgtggtgaaaaccaagttcgtgggaggcattgctcag
atcattgcagcccaggaggaaatgctgaagaaagaacgagagctggaggaagccaggaag
aagctggcccagatccgccagcagcagtacaaattcctccccacagagctgagggaagat
gagggctaa

DBGET integrated database retrieval system