KEGG   Mus musculus (mouse): 21897
Entry
21897             CDS       T01002                                 

Gene name
Tlr1
Definition
(RefSeq) toll-like receptor 1
  KO
K05398  toll-like receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04620  Toll-like receptor signaling pathway
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    21897 (Tlr1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    21897 (Tlr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    21897 (Tlr1)
   04090 CD molecules [BR:mmu04090]
    21897 (Tlr1)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   21897 (Tlr1)
CD molecules [BR:mmu04090]
 Proteins
  21897 (Tlr1)
SSDB
Motif
Pfam: TIR LRR_8 LRR_4 TIR_2 LRR_9 LRRCT Chorein_N
Other DBs
NCBI-GeneID: 21897
NCBI-ProteinID: NP_001263374
MGI: 1341295
Ensembl: ENSMUSG00000044827
Vega: OTTMUSG00000055138
UniProt: Q9EPQ1 B9EJ46
Position
5 C3.1; 5 33.53 cM
AA seq 795 aa
MTKPNSLIFYCIIVLGLTLMKIQLSEECELIIKRPNANLTRVPKDLPLQTTTLDLSQNNI
SELQTSDILSLSKLRVLIMSYNRLQYLNISVFKFNTELEYLDLSHNELKVILCHPTVSLK
HLDLSFNAFDALPICKEFGNMSQLQFLGLSGSRVQSSSVQLIAHLNISKVLLVLGDAYGE
KEDPESLRHVSTETLHIVFPSKREFRFLLDVSVSTTIGLELSNIKCVLEDQGCSYFLRAL
SKLGKNLKLSNLTLNNVETTWNSFINILQIVWHTPVKYFSISNVKLQGQLAFRMFNYSDT
SLKALSIHQVVTDVFSFPQSYIYSIFANMNIQNFTMSGTHMVHMLCPSQVSPFLHVDFTD
NLLTDMVFKDCRNLVRLKTLSLQKNQLKNLENIILTSAKMTSLQKLDISQNSLRYSDGGI
PCAWTQSLLVLNLSSNMLTGSVFRCLPPKVKVLDLHNNRIMSIPKDVTHLQALQELNVAS
NSLTDLPGCGAFSSLSVLVIDHNSVSHPSEDFFQSCQNIRSLTAGNNPFQCTCELRDFVK
NIGWVAREVVEGWPDSYRCDYPESSRGTALRDFHMSPLSCDTVLLTVTIGATMLVLAVTG
AFLCLYFDLPWYVRMLCQWTQTRHRARHIPLEELQRNLQFHAFVSYSGHDSAWVKNELLP
NLEKDDIQICLHERNFVPGKSIVENIINFIEKSYKSIFVLSPHFIQSEWCHYELYFAHHN
LFHEGSDNLILILLAPIPQYSIPTNYHKLKTLMSRRTYLEWPTEKNKHGLFWANLRASIN
VKLVNQAEGTCYTQQ
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgactaaaccaaattccctcatcttctactgtatcattgttttaggactgacacttatg
aaaatccaattatctgaggaatgtgagcttatcataaagaggccaaacgcaaaccttacc
agagtgcccaaggacctacccttgcaaacaactactttagatctatcacaaaacaatata
tctgagcttcagacttctgacatcctctcattgtccaagctgagggtcctgataatgtcc
tacaacagactccagtatcttaatatcagtgttttcaaattcaacacagagctggaatat
ttggatttgtcccacaatgagctaaaggtgatcttgtgccacccaacagtcagcctcaag
catttggacctctcctttaatgcctttgatgccctgcctatatgcaaagaatttggcaac
atgtcccaactacagttcctggggttgagcggttctcgggtacaaagttcaagtgtgcag
ctgattgctcatttgaacatcagtaaggttttgctggtgttaggagatgcttatggggaa
aaagaagaccccgaatctcttcggcacgttagcactgagactctgcatattgttttcccg
tcgaaaagagaattccgttttcttctggatgtgtccgtcagcactacgatcggtttggaa
ctgtctaacatcaagtgtgtgcttgaagaccagggctgctcttatttcttacgtgctttg
tcaaagcttggaaagaatctgaagctctcaaatcttaccctgaacaatgtggaaacaacg
tggaattccttcattaatatcctccagatagtttggcatacgccagtcaaatatttctca
atttcaaatgtgaagctacaaggtcaacttgccttcaggatgttcaattattctgacact
tctctgaaggctttgtcgatacatcaagttgtcactgatgtcttcagcttcccccaaagt
tacatatacagtatctttgccaatatgaacatccaaaactttacaatgtctggaacacac
atggtccacatgctgtgcccgtcccaagttagcccatttctgcatgtggactttacagat
aaccttttaacagacatggtttttaaagactgtagaaacttagttagattgaaaacactt
agtttacaaaagaatcagttaaaaaaccttgagaatataatcctcacatctgcaaagatg
acatccctacaaaaactagacattagccagaattctctaaggtacagcgatgggggaatc
ccatgcgcctggacccagagtttgttagttttaaatttgtcttcgaatatgcttacaggc
tctgtcttcagatgcttacctcccaaagtcaaggtccttgaccttcacaacaacaggata
atgagcatccctaaagatgtcacccacctgcaggctttgcaggaactcaatgtagcatcc
aactccttaactgaccttcctgggtgcggggccttcagcagcctttctgtgctggtcatc
gaccataactcagtttcccatccctctgaggatttcttccagagctgtcagaatattaga
tccctaacagcgggaaacaacccattccaatgcacatgtgagctgagggactttgtcaag
aacataggctgggtagcaagagaagtggtggagggctggcctgactcttacaggtgtgac
tacccagaaagctctaggggaactgcactgagggacttccacatgtctccactatcctgt
gatactgttctgctgactgtcaccatcggggccactatgctggtgctggctgtcactggg
gctttcctctgtctctactttgacctgccctggtatgtgaggatgctgtgtcagtggaca
cagaccaggcacagggccaggcacatccccttagaggaactccagagaaacctccagttc
catgcttttgtctcatacagtgggcatgattctgcctgggtgaagaacgaattactaccc
aacctagagaaagatgacatccagatttgcctccatgagaggaactttgtccctggcaag
agcattgtggagaacatcatcaatttcattgagaagagttacaagtccatctttgtgctg
tctccccacttcatccagagtgagtggtgtcattatgaactctattttgcccatcacaat
ctcttccatgaaggctctgataacttaatcctcatcttgctggcacccattccccagtac
tccatccctaccaattaccacaagctcaaaactctcatgtcacgaaggacctatctggaa
tggcccacagagaagaacaagcatggacttttttgggcaaacctaagagcatccattaat
gttaagctggttaaccaggcagaaggaacgtgttacacacagcaataa

DBGET integrated database retrieval system