KEGG   Mus musculus (mouse): 21899
Entry
21899             CDS       T01002                                 

Gene name
Tlr6
Definition
(RefSeq) toll-like receptor 6
  KO
K10169  toll-like receptor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04620  Toll-like receptor signaling pathway
mmu05132  Salmonella infection
mmu05142  Chagas disease
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21899 (Tlr6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    21899 (Tlr6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    21899 (Tlr6)
   05152 Tuberculosis
    21899 (Tlr6)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    21899 (Tlr6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21899 (Tlr6)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    21899 (Tlr6)
   04090 CD molecules [BR:mmu04090]
    21899 (Tlr6)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    21899 (Tlr6)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   21899 (Tlr6)
CD molecules [BR:mmu04090]
 Proteins
  21899 (Tlr6)
SSDB
Motif
Pfam: TIR LRR_8 TIR_2 LRR_4 LRR_9 LRRCT LRRNT TIR-like
Other DBs
NCBI-GeneID: 21899
NCBI-ProteinID: NP_035734
MGI: 1341296
Ensembl: ENSMUSG00000051498
Vega: OTTMUSG00000055139
UniProt: Q9EPW9 Q3UV88
Position
5 C3.1; 5 33.54 cM
AA seq 795 aa
MSQDRKPIVGSFHFVCALALIVGSMTPFSNELESMVDYSNRNLTHVPKDLPPRTKALSLS
QNSISELRMPDISFLSELRVLRLSHNRIRSLDFHVFLFNQDLEYLDVSHNRLQNISCCPM
ASLRHLDLSFNDFDVLPVCKEFGNLTKLTFLGLSAAKFRQLDLLPVAHLHLSCILLDLVS
YHIKGGETESLQIPNTTVLHLVFHPNSLFSVQVNMSVNALGHLQLSNIKLNDENCQRLMT
FLSELTRGPTLLNVTLQHIETTWKCSVKLFQFFWPRPVEYLNIYNLTITERIDREEFTYS
ETALKSLMIEHVKNQVFLFSKEALYSVFAEMNIKMLSISDTPFIHMVCPPSPSSFTFLNF
TQNVFTDSVFQGCSTLKRLQTLILQRNGLKNFFKVALMTKNMSSLETLDVSLNSLNSHAY
DRTCAWAESILVLNLSSNMLTGSVFRCLPPKVKVLDLHNNRIMSIPKDVTHLQALQELNV
ASNSLTDLPGCGAFSSLSVLVIDHNSVSHPSEDFFQSCQNIRSLTAGNNPFQCTCELRDF
VKNIGWVAREVVEGWPDSYRCDYPESSKGTALRDFHMSPLSCDTVLLTVTIGATMLVLAV
TGAFLCLYFDLPWYVRMLCQWTQTRHRARHIPLEELQRNLQFHAFVSYSEHDSAWVKNEL
LPNLEKDDIRVCLHERNFVPGKSIVENIINFIEKSYKAIFVLSPHFIQSEWCHYELYFAH
HNLFHEGSDNLILILLEPILQNNIPSRYHKLRALMAQRTYLEWPTEKGKRGLFWANLRAS
FIMKLALVNEDDVKT
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgagccaagacagaaaacccatcgtggggagtttccactttgtttgcgccctggcctta
atagtcggaagcatgaccccgttctctaatgaacttgagtctatggtagactattcaaac
aggaaccttactcatgtccccaaagacctgccaccaagaacaaaagccctgagtctgtct
caaaactctatatctgagcttcggatgcctgatatcagctttctgtcagagctgagagtt
ctgagactctcccacaacaggatacggagccttgatttccatgtattcttgttcaatcag
gacttagaatacctggatgtctcacacaatcggttgcaaaacatctcttgctgccctatg
gcgagcctgaggcatctagacctctcattcaatgactttgatgtactgcctgtgtgtaag
gaatttggcaacctgacgaagctgactttcctgggattaagtgctgcaaagttccgacaa
ctggatctgctcccagttgctcacttgcatctaagctgcattcttctggacttagtgagt
tatcatataaaaggcggggaaacagaaagtcttcagattcccaataccaccgttctccat
ttggtctttcatccaaatagcttgttctctgttcaagtgaacatgtctgtaaacgcttta
ggacatttacaactgagtaatattaaattgaatgatgaaaactgtcaaaggttaatgaca
tttttatcagaactcaccagaggtccaaccttattgaatgtgaccctccagcacatagaa
acaacctggaagtgctcggttaaacttttccaattcttttggccccgaccggtggagtac
ctcaatatttacaacttaacgataactgagagaatcgacagggaagaatttacttactcg
gagacagcactgaagtcactgatgatagagcacgtcaaaaaccaagtgttcctcttttca
aaggaggcgctatactcggtgtttgctgagatgaacatcaagatgctctctatctcagac
acccctttcatccacatggtgtgcccgccatccccaagctcatttacatttctgaacttt
acccagaatgtttttactgacagtgtttttcaaggctgttccaccttaaagagattgcag
acacttatcttacaaaggaatggtttgaagaacttttttaaagtagctctcatgactaag
aatatgtcctctctggaaactttggatgttagtttgaattctttgaactctcatgcatat
gacaggacatgcgcctgggctgagagcatattggtgttgaatttgtcttcgaatatgctt
acaggctctgtcttcagatgcttacctcccaaggtcaaggtccttgaccttcacaacaac
aggataatgagcatccctaaagatgtcacccacctgcaggctttgcaggaactcaatgta
gcatccaactccttaactgaccttcctgggtgtggggccttcagcagcctttctgtgctg
gtcatcgaccataactcagtttcccatccctctgaggatttcttccagagctgtcagaat
attagatccctaacagcgggaaacaacccattccaatgcacatgtgagctgagggacttt
gtcaagaacataggctgggtagcaagagaagtggtggagggctggcctgactcttacagg
tgtgactacccagaaagctctaagggaactgcactgagggacttccacatgtctccactg
tcctgtgatactgttctgctgactgtcaccatcggggccactatgctggtgctggctgtc
actggggctttcctctgtctctactttgacctgccctggtatgtgaggatgctgtgtcag
tggacacagaccaggcacagggccaggcacatccccttagaggaactccagagaaacctc
cagttccatgcttttgtctcatacagtgagcatgattctgcctgggtgaagaacgaatta
ctacccaacctagagaaagatgacatccgggtttgcctccatgagaggaactttgtccct
ggcaagagcattgtggagaacatcatcaatttcattgagaagagttacaaggccatcttt
gtgctgtctccccacttcatccagagtgagtggtgccattatgaactctattttgcccat
cataatctcttccatgaaggctctgataacttaatcctcatcttgctggaacccattcta
cagaacaacattcccagtagataccacaagctgcgggctctcatggcacagcggacttac
ttggaatggcctactgagaagggcaaacgtgggctgttttgggccaaccttagagcttca
tttattatgaagttagccttagtcaatgaggatgatgtgaaaacttga

DBGET integrated database retrieval system