KEGG   Mus musculus (house mouse): 219038
Entry
219038            CDS       T01002                                 
Symbol
Tppp2, Gm1790, Gm77
Name
(RefSeq) tubulin polymerization-promoting protein family member 2
  KO
K25698  tubulin polymerization-promoting protein family member 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    219038 (Tppp2)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   219038 (Tppp2)
SSDB
Motif
Pfam: p25-alpha CbiK
Other DBs
NCBI-GeneID: 219038
NCBI-ProteinID: NP_001122106
MGI: 2684923
Ensembl: ENSMUSG00000008813
UniProt: Q0P5Y3
Position
14:52155887..52158161
AA seq 170 aa
MASEAERTFHRFAVFGESSSSSKEITNKNFSKLCKDCDIMDGKAVTSTDVDIVFSKVKAK
NARTINFQQFQEAMKELGQKRFKGKNPDEALQGVFKLMEGKDPATTGVTKSTTVGGVDRL
TDTSKYTGTHKERFDESGKGKGIEGREETTDNSGYVSGYKGAGTYDKKNQ
NT seq 513 nt   +upstreamnt  +downstreamnt
atggcctcagaagcagaaagaacattccatcgattcgctgtctttggagaatcatccagc
agcagcaaggaaattaccaacaagaacttctccaaactctgtaaagactgtgatatcatg
gatggcaaggcagtgacctccacagatgtggacattgtgttcagcaaagtgaaggccaag
aatgccagaaccatcaactttcaacagtttcaagaggcaatgaaggagctgggccaaaag
cgcttcaaggggaagaacccagatgaggctttgcaaggtgtttttaaactcatggaaggc
aaagatcctgccaccaccggtgtcactaaatcaacgacggtgggtggagtagaccggttg
acagacaccagtaagtacaccggaactcacaaggagcgctttgatgagagtggtaaggga
aaaggtattgaaggtcgggaagagaccactgacaactcaggctacgtgagtggctacaag
ggggccggcacctatgacaagaaaaaccagtag

DBGET integrated database retrieval system