KEGG   Mus musculus (house mouse): 219105
Entry
219105            CDS       T01002                                 
Symbol
Zmym5, 9830124H08Rik
Name
(RefSeq) zinc finger, MYM-type 5
  KO
K24676  zinc finger MYM-type protein 5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    219105 (Zmym5)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Zinc finger domain-containing proteins
  MYM-type zinc finger domain-containing proteins
   219105 (Zmym5)
SSDB
Motif
Pfam: zf-FCS YHS zf-FLZ ATPase-cat_bd Pox_P4B
Other DBs
NCBI-GeneID: 219105
NCBI-ProteinID: NP_001240681
MGI: 3041170
Ensembl: ENSMUSG00000040123
UniProt: Q3U2E2
Position
14:complement(57028042..57049213)
AA seq 627 aa
MEAHLADMESSGGPTSSLAGTSRNTHVEDDDVVFIESVQPPICAPAIPNERNFVFASSKH
ENPPGTDSTISPSWRDLTSQKGNLCETIVIDDEGDTDTNGGEEKNPTDFIEWGPNGNKSS
TKNVDFPIASLSRSKTKTAVGPFNPGRIDVTDAFQNGRFAVHHNPDSWISQSASFPRNQK
QQGVDSLSPVASLPKQIFQPSNQQPTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTT
CLSSFSHKRTRKTRNVMCKKDSPVRTTTIVPPVESSKSLQGFYNASLSPYENCQSLRKEV
FTKSRCIICNKLGEVRHEISVNSITHKLCSNNCFNEYRLTNGLIMNCCEQCSKYMPKSTG
HSILITGQQKRFCCQNCADEYKEIMEAKSKLLLLQNRKRNAIREENEKRLRESSGTLSGN
TGDIPEKKEKSSEIIKVAADCSLDTSSEEQNVNLPCSVAVISDTFKEQLGDKNSEELDMS
ILPSLDPGSWPRILNMKQREFLVKNNPPQIRNFNFPKDSAGKKFSETYYTRILPNGEKGT
RPWLLYSASKDSVFCLYCRLFGEGKNQLRNENGCKDWHHLSHLLSKHDESEMHINNSVKY
SKLKSDLENKTNEATEGGEDCVQLLYT
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggaagctcatctcgcagatatggaatcatctgggggtccaactagttctttagccggt
acatctagaaacacacatgtggaagatgatgatgttgtatttattgaatcagtacagcct
ccaatttgtgctccagcaatacctaatgaaagaaactttgtatttgcttcctcaaaacat
gaaaatccaccaggaactgattccacaatttccccttcttggagagatttgacttctcag
aagggaaatctatgtgaaacaattgtaattgatgatgaaggggacacagacacaaatgga
ggggaggagaaaaatcctaccgactttattgaatggggaccgaatggaaataaaagtagt
accaaaaatgtggatttccccattgccagtctatcaagaagcaagaccaagactgcagta
ggaccttttaatcccggtaggatcgatgtcacggatgcgtttcagaatggaagatttgca
gttcatcacaatcctgattcttggatctcccagtcagcatcatttcctcgtaaccagaaa
caacaaggggtggattctttatcaccagtggcctcacttcctaaacagatattccagccc
tcgaaccaacaacccactaaaccagttaaagtcacttgtgcaaactgcaaaaaacctcta
cagaaggggcagacagcttaccagcgaaaaggatcagctcacctcttctgttcaaccacc
tgcctttcttctttctcccataagcgtactcgaaagacacggaatgtaatgtgtaaaaaa
gattctcctgtgagaaccacaactattgttcctccagtggagtcaagcaagtccttacaa
ggattttataatgcatcgctatctccctatgaaaactgccagagtcttaggaaagaagtt
tttactaagtcaagatgtataatctgtaataaattaggagaggttcgccatgaaatcagt
gttaacagtataacacataagctgtgcagtaataattgctttaatgaatacagattgacg
aatggtctaataatgaactgctgtgaacagtgtagcaagtatatgcccaagagtactggg
cacagcattctgataacaggtcagcaaaagagattctgctgccagaattgtgctgacgaa
tataaagagataatggaagcaaaatcaaaactactgcttttacaaaatagaaaaaggaat
gctatcagagaagaaaatgaaaaacgattacgtgaatcatcaggtacactttcaggaaac
acaggagacatacccgaaaaaaaggaaaagtcttcagagataataaaagtcgcagcagac
tgtagcctagatacatcatcagaggaacaaaatgtgaatttaccttgttctgtggcagta
atatctgatacatttaaagagcaactaggagacaaaaattcagaggaattggatatgtcc
attttaccttctttggatccaggttcatggccccgaattttgaatatgaaacaacgtgaa
tttcttgtcaaaaacaatccacctcaaataagaaattttaattttccaaaagatagtgca
ggcaagaagttttcagaaacgtattatacccgaattcttccaaatggtgaaaagggcacc
agaccctggctgctctactcagcctcgaaagactctgtgttttgcctgtattgcagactc
tttggggaaggaaaaaaccaactgagaaatgagaatgggtgcaaagattggcatcatttg
tcacatcttcttagtaaacatgacgaaagtgaaatgcacatcaacaatagtgttaagtat
tcaaaattaaagtctgacttggaaaataaaaccaatgaagctacagaaggtggggaagat
tgtgtgcagctactgtacacataa

DBGET integrated database retrieval system