KEGG   Mus musculus (mouse): 21912
Entry
21912             CDS       T01002                                 

Symbol
Tspan7, 1200014P11Rik, A1, A15, AI323365, Cd231, Mxs1, PE3, PE31, R74651, T, TALLA, Tm4sf, Tm4sf2
Name
(RefSeq) tetraspanin 7
  KO
K06571  tetraspanin-7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    21912 (Tspan7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21912 (Tspan7)
   04090 CD molecules [BR:mmu04090]
    21912 (Tspan7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   21912 (Tspan7)
CD molecules [BR:mmu04090]
 Proteins
  21912 (Tspan7)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 21912
NCBI-ProteinID: NP_062608
MGI: 1298407
Ensembl: ENSMUSG00000058254
Vega: OTTMUSG00000016730
UniProt: Q62283
Position
X; X A1.1
AA seq 249 aa
MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPY
VLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTF
LRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETD
CNPLDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF
ITANQYEMV
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcatcgaggagaatggagaccaaacctgtgataacctgtctcaaaaccctcctcatc
atctactccttcgtcttctggatcactggggtgatcctgttggccgttggagtctgggga
aagctgactttgggaacctatatctccctgattgctgagaactccacaaatgctccctat
gtgctcattggaaccggcaccaccatcgtggtttttggcctctttggatgctttgctaca
tgccgtggtagtccatggatgctgaaactgtatgccatgttcctgtccctggtgttcctg
gctgagcttgttgctggcatttctggatttgtgtttcgtcatgagatcaaggacaccttc
ctgaggacttacacggatgccatgcagaactacaatggcaatgatgagaggagccgggct
gtggaccatgtgcagcgcagcctgagctgctgtggcgtgcagaactacaccaactggagc
agcagcccctacttcctggaccatggcatcccccccagttgctgcatgaacgaaactgac
tgcaatcccctggatctgcacaatctgactgtggccgccaccaaagttaatcagaagggc
tgttatgatctggtgaccagttttatggagactaacatggggatcattgctggagtggca
tttggaattgcgttctcccagttgattggcatgctgctggcttgctgtctgtcccggttc
atcactgccaatcagtatgagatggtgtaa

DBGET integrated database retrieval system