KEGG   Mus musculus (mouse): 219181Help
Entry
219181            CDS       T01002                                 

Gene name
Akap11, 6330501D17Rik, AKAP220, Gm80, PRKA11, mKIAA0629
Definition
(RefSeq) A kinase (PRKA) anchor protein 11
  KO
K16527  A-kinase anchor protein 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    219181 (Akap11)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     219181 (Akap11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 219181
NCBI-ProteinID: NP_001157975
MGI: 2684060
Ensembl: ENSMUSG00000022016
Vega: OTTMUSG00000032614
UniProt: E9Q777 Q8BSJ2
Position
14; 14 D3
AA seq 1894 aa AA seqDB search
MAAFQPLRSSHLKSKASVRKSFSEDVFRSVKSLLQSEKELCSVSGGECLNQDEHPQLTEV
TFLGFNEETDAAHIQDLAAVSLELPDLLNSLHFCSLSENEIICMKDTSKSSNVSSSPLNQ
SHHSGMLCVMRVSPTLPGLRIDFIFSLLSKYAAGIRHTLDMHAHPQHHLETTDEDDDDTN
QSVSSIEDDFVTAFEQLEEEENAKLYNDEINIATLRSRCDAASQTTSGHHLESHDLKVLV
SYGSPKSLAKPSPSVNVLGRKEAASVKTSVTTSVSEPWTQRSLYRCPSASDKDKDTQETF
FPSPVYSSESECSSPSPVIFLDEEGYQKSLKAKLELPEIPVTKDDVEDSDSEVSEFFDSF
DQFDELEQTLETYLLMEDPIIGKSSQKIGHKYEKSCMNPQKFKFERPALPANVRKPTPRK
PESPYGHLSDAPDSPRPVMTSEDSGLFSPIRTSAFSPPGSCTPAEWFCQTDTSENRNHEN
YCTYEDYANNLSCEVLGSVLHTQHANTMSDINSIKRGRNHTVTFKYGDSDQKSKCKKSSV
ITGSVQKFAADLVGKSLGSAFKDLQKGVSSCTNTLCHLAVKLTSSVFQMAFNELRRQCAF
SLKERAIGSLASLLVSDALSNALKDLQYVKKQMFTNTVARFAADLAEELVFEGIMEVCQF
SCPQTPASSQCQSFDFEDKVVKSYAKDLSESVIQEAFIELSQTNVTFTTKAAVNVSMGNV
KYVSAESVSPTQTFTFSSSFSGQAVMMTKPMQEHKKEYTVQQALFCTSGIVTSIPVPLAG
SALLPYHMSSTLYPSKCLSSEPSKASGGSTQEHIAIERSAEEVDCLRSTCLPSELNPCNQ
NDFKPTNGDIDRQSPSKLMSGPVIISNFSAAMVHTIVNETLESMTSFKATKTIDTNADYL
TKTIKGKACSPSLCDQAAPQENKASSKDMFAEQLSKSIIKHSLDKSKSMLPNRDKKPGSK
EHVLVLGEESQMTLGETPKFLDFSDNSPHRSLLVGNYCVAECKDSVGFGFSLEALPPCSM
MTNQKSDLKEVVKDKEVTRHNLNNTALEPMPFGQESSFRHSQTFSSAVLTCVDGLHEEDK
QKIRDRNVIPDTPPSTPLVPSQTSSEWDIKTLSKQLKGELAKEFAPATPPSTPHNSSVGS
LSENEQTTIEKEEFMLKLMRSLSEEVESSEGEEHPGMHVKAEHPGKKVQFAEAFATHIIS
LATEAAASHLDHETTQEFKVQNPHLNVPSQRNVLPALSHSDESIQTCTFASDMAADVIAE
AEKIANARSCMLFRHERNICHVEGGRGKAEEKLDVEDVAHPREVDTCVLSLPSGMPGLTY
KYPSCESVTDEYAGHVIQVLQQQGGSGELIMEQYASRLAYRSVTAAAREAAKTVKMKCGS
KLFPLHGCHGKTNKELLVFSSKERHQEVDRQRKRNGSHLCKYQTCERTQDPCRNELSELY
SFSASLASSITRDAKKQLTAPKVDLPKSSTDGCFFEKSECVDSSENVTGPERSKSCQPLQ
SHGFCQNTGYLSGYSCAENAQAIEQYARKVVGDTLELSLGPTVFHNSETTASADRITYAE
KLSPLINEACRYCDLKEFHGCTRNSAQLFSKQSPCASAKPSSRSKLSSIRQKSRIFHLDV
PQIHVNLDKRAVLAEKIVAEAIEKAERELSNTSLAADSGIGQDGISFAESLTTEIMTTAV
TNAGHAVSSSREIEDFQSTESLGSQQMNLSVGEDSTGSWSNLSFEDDHQDESSSFHHLSE
SNGNSSSWSSLGLEGDLYEDNLSFPTSDSDGSDDGDDEQEDGVEDLQQNGKTLLIMNIDM
EPGAVDPQLRIILQWLIASEAEVAELYFQDSAKKEFILLSKQLQEKGWKVGDVLQAVLKY
YEVVEKPSREERCKSLFDWLLENAQNRLQTSMLV
NT seq 5685 nt NT seq  +upstreamnt  +downstreamnt
atggcggctttccagcccctcaggagtagtcacctaaagagcaaagcgtctgtccgaaaa
agcttcagtgaagatgtgttccggtctgtaaagtctttattacagagcgagaaggagcta
tgcagtgtatcaggaggagagtgtttaaaccaggatgagcacccccagttaactgaggtc
acgtttctgggctttaatgaagaaacagatgctgctcatatacaggatctagctgcagtt
tcattggaacttccagatcttctgaattcgctccatttttgcagtctaagtgaaaatgaa
atcatttgtatgaaggataccagtaaatcgtccaatgtaagcagtagtcctctaaatcag
agtcatcattcgggaatgctttgtgtcatgagagtgtcacctacattaccgggactcaga
attgattttatctttagtctcctaagtaaatatgctgctggcataagacacaccctggac
atgcacgcgcatccgcagcaccaccttgagaccactgatgaagatgatgatgataccaac
cagtctgtgtcttccatagaggatgactttgtcactgcttttgagcagttagaggaggaa
gaaaatgcaaagctatataatgatgaaataaatattgctacactaaggagccggtgtgat
gctgcttctcagactacttcaggccaccatttagaaagccatgatttaaaagtgctggtt
agttatggatcaccgaagtcactggctaagccctcaccttcagtaaatgtactgggacgc
aaggaagctgcttctgtgaaaacatctgttacaacatcggtttcagagccctggacccag
aggagtctctacaggtgccccagtgcctccgataaagacaaggacacacaggagacattc
tttccttctcctgtctactcctcagagtctgagtgctcaagcccaagtcctgtgattttt
ttggatgaagagggatatcaaaaaagtttaaaagcgaaacttgagctgcctgaaattcct
gtgacaaaagatgatgtagaagattcagactcagaagtgagtgaattttttgatagcttt
gatcagtttgatgaactagagcaaactttggagacttacttgctcatggaagatcctatc
atagggaagtcatcacagaagatagggcacaaatatgaaaaatcttgtatgaatcctcag
aaattcaagtttgagcgtccagctcttccagctaatgttagaaagccaactcctcgcaaa
cctgagtctccgtatggtcacctgtctgatgctccagattcccctcgtccggtgatgaca
tcagaggatagtggcttgttcagccctattcgaacctcagcttttagtcctcctggaagc
tgtactcctgctgaatggttttgccaaacagatactagtgaaaataggaatcatgaaaat
tactgcacttatgaggattatgcaaataatctttcgtgtgaagtactaggctcagttctt
catactcaacatgcaaacacaatgtcagatattaatagtattaaaaggggaagaaatcat
acggtaacttttaagtatggagactctgatcaaaaaagtaaatgtaaaaaatcttcagtg
attacaggtagcgttcagaagtttgcagcagatcttgtggggaaaagtttgggcagtgcg
tttaaagacttacagaaaggagtttcttcatgtaccaataccttatgccacttagctgtc
aaattgacttcgtctgtatttcagatggcatttaatgaacttagaaggcagtgtgcattt
tcactaaaagaacgagccattggtagcctggccagtcttttggtgagtgatgccttatca
aatgccttgaaagacttacagtatgtaaaaaagcagatgtttacaaacacagttgctagg
tttgctgcggaccttgctgaagaacttgtttttgaaggtatcatggaagtgtgtcagttt
tcatgtcctcaaacacctgcatcttcacagtgtcagtcatttgactttgaagacaaagtc
gtgaagtcctatgccaaagatttgtctgaatctgtaatacaagaagcattcatagaactg
tcacagactaatgtgacgtttacaacaaaggcagcagttaatgtttctatgggtaatgtc
aagtatgtgagtgcagaaagtgtatcacctacgcagacctttacattttcctcatccttc
agcggtcaagcagttatgatgacaaaaccaatgcaggagcataagaaggaatacacagtg
cagcaggctttgttttgtacctcaggaattgtcacttctataccagtgcccttggccggt
agtgcccttctcccgtatcatatgtcatctactttgtatccttccaagtgtctttcatct
gagcctagtaaagcaagtggtggctctacccaagaacacattgccatagaacgcagtgca
gaggaagtagattgtctcagaagtacctgtctaccttcagaactcaatccatgcaaccag
aatgacttcaaaccaactaatggtgatattgacaggcagagtccttcaaagttaatgagt
ggccctgtaattattagcaacttttccgcagcaatggtacatacaatagtaaatgaaacc
ttagagtccatgacgtccttcaaagctacaaaaactattgatacaaatgcagattattta
actaaaacaataaagggaaaagcctgttctccttccctttgtgaccaagcagcaccacag
gagaacaaagctagcagtaaggacatgtttgctgagcagttatcaaagtctattattaaa
cattccctggataaaagcaagtcaatgcttccaaatagagataaaaaacccggtagtaag
gaacacgtgcttgttcttggagaagaatcacagatgaccttgggggaaactcccaaattc
cttgacttttcagataactcacctcatcgttcactcctggttggaaactattgtgtcgca
gaatgtaaagattctgtgggttttggattttctctagaggcactgccaccttgttcaatg
atgacaaatcagaaatctgacttaaaggaagttgtgaaggacaaagaagtgacaaggcac
aatttgaataatactgcacttgagcccatgccttttggacaggaaagctctttccgtcac
tcacagactttctcatctgcagtgcttacctgtgtagatggtttgcatgaggaagataag
cagaaaatccgagacagaaatgtaatacctgatactcccccatcgactcctttagtgcca
tcccagactagttctgaatgggacatcaaaacattaagcaaacaactcaagggggagtta
gccaaagaatttgcacccgcaacaccaccttcaacgcctcacaactcatctgttggtagt
ttgtctgagaatgaacaaactactatagaaaaggaagaatttatgttgaagctcatgcgc
tctctttcagaagaagttgagagcagtgaaggtgaagaacacccaggaatgcatgtaaag
gcagagcacccggggaaaaaagtccagtttgcagaagcattcgccacacacatcatttct
cttgcaactgaagcggcagcctcccacttagatcatgagactactcaagaattcaaggtt
caaaaccctcacttaaatgtaccaagtcaaagaaatgtgctgccagctttaagtcattcc
gatgaaagcatacagacgtgcacttttgcaagtgatatggcagctgatgtcattgcagaa
gccgagaagattgcaaacgctagaagctgtatgcttttcaggcatgagaggaacatttgt
catgttgaaggtggccgaggtaaagcagaagagaaactggatgtggaagatgttgcacat
ccaagagaagtcgatacttgtgttctttcattaccaagtggcatgccaggtctgacatac
aagtatcccagttgtgaaagtgtgactgatgagtatgcagggcatgttattcaggtgctc
caacagcaaggtggcagtggagagctaatcatggagcagtatgccagcagactggcctac
cggtctgtcactgcagcagctcgggaagcagctaagacagtgaaaatgaagtgcggttcg
aaactcttccctctgcacggctgtcatgggaaaacaaacaaggaactgttggtgttctca
agtaaagagcgtcaccaagaagtcgatagacaaagaaaaagaaatggcagccatctttgc
aaataccagacatgtgaaaggacacaggatccgtgtagaaatgaactttctgaactgtac
agtttttcagcctctcttgctagcagcataacaagagatgcaaagaaacagctcacagca
cctaaagttgacttgccaaaatcctcaacagatggttgtttttttgaaaaatctgaatgt
gttgacagcagtgagaatgttactggaccagaacgttcaaagtcttgtcaacctttgcaa
agccatggattttgccagaatacaggctatctaagtggatatagttgtgcagagaatgct
caagctatagaacagtatgctagaaaagtagtgggtgacactttagagctaagtttagga
cccacagtttttcataattcagagaccacagcatcagcagatagaattacttacgcagaa
aaattgtcaccgcttataaatgaagcttgcagatactgtgaccttaaggaattccatggt
tgcaccagaaattctgctcagctcttttcaaagcagagtccgtgtgctagtgctaagcca
agttcacgttcaaaacttagtagcattcgtcagaaatcaagaatttttcatcttgatgta
cctcagattcatgttaatcttgataaaagggcagtgcttgctgagaagatagttgctgaa
gctattgagaaagcagagagagagttgagcaacacgagtttggcagctgatagtggaatc
ggacaagatggcattagctttgctgagagccttactacagaaatcatgacaacagctgtg
acaaatgctgggcatgctgttagcagttcaagagaaatagaagattttcagtcaactgag
tcacttggcagccagcagatgaatctcagtgttggtgaagacagcacaggtagctggtcc
aacttaagttttgaggatgaccatcaagatgaaagcagcagtttccatcatctcagtgaa
agtaatggtaacagcagtagctggagcagtcttggtttagaaggagatttgtatgaggac
aatttatcctttccaacatcagacagtgatggatcggatgatggagatgacgagcaggag
gatggtgtggaagatttgcagcaaaatggaaagactctgctaattatgaacattgacatg
gagcctggagctgtagacccgcaattaaggattattcttcagtggctcattgcctctgag
gctgaagttgcagaactttattttcaggactctgcaaagaaggagtttatattactttca
aagcagttacaagagaaaggatggaaagtgggagatgtcctgcaggctgtgcttaaatac
tacgaagtggtggaaaagccctcaagggaggaaagatgcaagtcgctgtttgattggctt
ttagaaaatgcccagaacagactccagaccagtatgcttgtctag

DBGET integrated database retrieval system