KEGG   Mus musculus (house mouse): 21923
Entry
21923             CDS       T01002                                 
Symbol
Tnc, C130033P17Rik, Hxb, TN, TN-C, Ten, cytotactin, tenascin-C
Name
(RefSeq) tenascin C
  KO
K06252  tenascin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21923 (Tnc)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21923 (Tnc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21923 (Tnc)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    21923 (Tnc)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21923 (Tnc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21923 (Tnc)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21923 (Tnc)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_2 EGF_Tenascin EGF Pur_ac_phosph_N NDNF fn3_2 hEGF Interfer-bind DUF4998
Other DBs
NCBI-GeneID: 21923
NCBI-ProteinID: NP_035737
MGI: 101922
Ensembl: ENSMUSG00000028364
UniProt: Q80YX1 Q148T5 Q8C9Z1
Position
4:complement(63878022..63965554)
AA seq 2019 aa
MGAVTWLLPGIFLALFALTPEGGVLKKIIRHKRESGLNMTLPEENQPVVFNHIYNIKLPM
GSQCSVDLESASGEKDLTPTPESSGSFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELELLVSSLREQCTMGTGCCLQPAEGRLDTRPFCSGRGNFSAEGCGCVCEPGW
KGPNCSEPDCPGNCNLRGQCLDGQCICDEGFTGEDCSQLACPNDCNDQGRCVNGVCVCFE
GYAGPDCGLEVCPVPCSEEHGMCVDGRCVCKDGFAGEDCNEPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGELTCPNDCQGRGQCEEGQ
CVCNEGFAGADCSEKRCPADCHHRGRCLNGQCECDDGFTGADCGDLQCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQRRCPNDCHNRGLCVQGKCICEQGFKGFDCSEMSCPNDCHQHGRC
VNGMCICDDDYTGEDCRDRRCPRDCSQRGRCVDGQCICEDGFTGPDCAELSCPSDCHGHG
RCVNGQCICHEGFTGKDCKEQRCPSDCHGQGRCEDGQCICHEGFTGLDCGQRSCPNDCSN
QGQCVSGRCICNEGYTGIDCSEVSPPKDLIVTEVTEETVNLAWDNEMRVTEYLIMYTPTH
ADGLEMQFRVPGDQTSTTIRELEPGVEYFIRVFAILENKRSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKKVTTTRLDAPSHIEVKDVTDTTALITWFKPLAEIDSIELSYGIK
DVPGDRTTIDLTHEDNQYSIGNLRPDTEYEVSLISRRVDMASNPAKETFITGLDAPRNLR
RVSQTDNSITLEWRNVKADIDSYRIKYAPISGGDHAEIDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKGDKESDPATINAATEIDAPKDLRVSETTQDSLTFFWTTPLAKFDRYRLNYS
LPTGQSMEVQLPKDATSHVLTDLEPGQEYTVLLIAEKGRHKSKPARVKASTEEVPSLENL
TVTEAGWDGLRLNWTADDLAYEYFVIQVQEANNVETAHNFTVPGNLRAADIPGLKVATSY
RVSIYGVARGYRTPVLSAETSTGTTPNLGEVTVAEVGWDALTLNWTAPEGAYKNFFIQVL
EADTTQTVQNLTVPGGLRSVDLPGLKAATRYYITLRGVTQDFGTAPLSVEVLTEDLPQLG
GLSVTEVSWDGLTLNWTTDDLAYKHFVVQVQEANNVEAAQNLTVPGSLRAVDIPGLKADT
PYRVSIYGVIQGYRTPMLSTDVSTAREPEIGNLNVSDVTPKSFNLSWTATDGIFDMFTIE
IIDSNRLLQTAEHNISGAERTAHISGLPPSTDFIVYLSGIAPSIRTKTISTTATTEAEPE
VDNLLVSDATPDGFRLSWTADEGIFDSFVIRIRDTKKQSEPQEISLPSPERTRDITGLRE
ATEYEIELYGISRGRRSQPVSAIATTAMGSPKEIMFSDITENAATVSWRAPTAQVESFRI
TYVPMTGGAPSMVTVDGTDTETRLVKLTPGVEYRVSVIAMKGFEESDPVSGTLITALDGP
SGLLIANITDSEALAMWQPAIATVDSYVISYTGERVPEVTRTVSGNTVEYELHDLEPATE
YILSIFAEKGQQKSSTIATKFTTDLDSPREFTATEVQSETALLTWRPPRASVTGYLLVYE
SVDGTVKEVIVGPDTTSYSLADLSPSTHYSARIQALSGSLRSKLIQTIFTTIGLLYPFPR
DCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKA
YAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLK
VEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNN
HSQGVNWFHWKGHEYSIQFAEMKLRPSNFRNLEGRRKRA
NT seq 6060 nt   +upstreamnt  +downstreamnt
atgggggccgtgacctggctactgccaggcatctttctagctttgtttgccctcactccc
gaaggtggggtcctcaagaaaatcatcaggcacaagcgagagagtgggctaaacatgacc
ctgccagaagagaatcagccagtggtgttcaaccatatctacaacatcaagttgcccatg
ggttcccaatgctcagtggatctggagtcagcgagtggggagaaagacctgacccccacg
ccagagtccagtgggagcttccaggaacatacagtggatggggaaaaccaaattgtattc
acacaccgcatcaacatcccccgccgggcctgtggctgtgctgcagctccagatgtgaag
gagctcctgagcaggctggaggagctggagttgctggtatcgtctctaagggagcagtgc
accatgggtacaggctgttgcctccaacctgcagaaggtcgtctggacaccaggcccttc
tgcagcggacggggcaacttcagtgcagaaggctgcggctgtgtctgtgaaccaggctgg
aaaggccccaactgctctgagcctgactgccctgggaactgtaatctcagaggccagtgc
cttgacggccagtgtatctgtgacgagggtttcactggggaagactgcagccagctggcc
tgtccgaacgactgcaatgaccagggcaggtgtgtgaacggggtctgtgtgtgcttcgaa
ggctatgccggccctgactgtggcctggaagtctgcccagtgccctgcagcgaggaacac
gggatgtgtgtggatggcaggtgtgtgtgcaaagatggctttgcgggtgaggactgcaac
gagcccctttgcctcaacaactgctacaatcgtgggcggtgtgtggagaacgagtgtgtc
tgcgacgagggcttcactggcgaggactgcagtgagctcatttgccccaacgactgcttc
gaccgcggtcgctgcatcaatggcacctgctactgtgaagaaggtttcacgggcgaagac
tgcggtgagctcacctgccccaacgactgtcagggccgtggccagtgtgaggagggacag
tgtgtttgcaacgagggctttgcaggagcagactgcagtgaaaagcggtgtcccgccgat
tgtcaccaccgtggccgctgcctcaacgggcagtgtgagtgtgacgatgggttcacaggg
gctgactgtggggatctccagtgtcccaatggctgcagtgggcatggccgttgtgtcaac
gggcagtgcgtgtgtgacgagggctataccggagaagactgtagccagcggcgatgcccc
aatgactgtcacaaccggggtctctgcgtacagggcaagtgcatatgtgaacaaggcttc
aagggctttgactgtagtgagatgagctgtcccaatgactgccaccaacatggccgctgt
gtgaatggcatgtgtatctgtgatgacgactacactggggaagactgcagagaccggcgc
tgtccccgggactgtagccagcgggggcgctgtgtagacggacagtgcatctgtgaggat
ggcttcactggccctgactgtgctgagctttcctgccccagtgactgccacggccatggc
cgctgtgtgaatggccaatgcatctgccacgagggcttcactggcaaagactgcaaagag
caaaggtgccccagtgattgccatggccaaggccgctgtgaggacggccagtgtatctgc
catgagggctttacgggcctggactgtgggcagcgctcctgtcccaatgactgcagcaac
caaggacaatgtgtgtcaggccgctgcatctgcaatgaaggttacacagggatagactgc
tctgaggtgtcccctcccaaagaccttattgtgacagaagtaacagaggagactgtaaat
ctggcatgggacaatgagatgcgggtcactgagtacctcattatgtacacacccacccat
gctgatggcctagagatgcagttccgtgtgcctggggaccagacatccaccaccattcgg
gagctggaaccaggggtggagtacttcattcgtgtgttcgccatcttggaaaacaagagg
agcatccctgtcagtgccagggttgccacctatttgcctgcacctgaaggtctaaaattc
aagtctatcaaggagacatctgtggaagtagagtgggatcctctagacattgctttcgaa
acatgggagatcattttccgaaatatgaacaaagaagatgagggagagatcacaaaaagt
ctgaggagaccagagacctcctaccgccaaactggccttgctcctggccaagagtatgaa
atatctctgcacattgtgaaaaacaacacccgaggccccggcttgaagaaagtaaccaca
acccgcctggatgcccccagccatattgaggtgaaagatgtcacagacaccacagcactg
atcacctggttcaagcccttggctgaaattgatagcattgagctctcctatggcatcaag
gatgtacctggagaccgtaccaccatcgacctcacacacgaagacaaccagtactccatc
gggaacctgagacctgacacggagtatgaggtgtccctcatctcccgcagagtggacatg
gcaagcaaccctgccaaagagaccttcatcacaggcctggatgctcccaggaatctccgc
cgtgtctcacagacagacaacagcatcaccttggagtggaggaacgtcaaggcagacatc
gacagttacagaattaagtatgcccctatctctggaggtgaccatgctgagatagatgtt
ccaaagagccagcaagccacaaccaaaaccacactcacaggtctaaggcccggaactgaa
tatgggattggtgtttctgctgtcaagggagacaaggagagtgatccagcaaccatcaat
gcggccacagaaattgatgcacccaaggacttacgggtgtctgaaaccacacaagacagt
ctgacgtttttctggacgacacccctggccaagtttgatcgttaccgcctcaactacagc
ctccccacaggccagtcgatggaagtccagctgccaaaggatgccacctcccatgtcctg
acagacctggagccagggcaagaatacactgttctcctcattgctgagaagggcagacac
aagagcaagcctgcacgtgtgaaggcatccacggaagaagtgccttccctggaaaatctc
actgtgactgaggccggctgggatggcctcagactcaactggactgcagatgacctggcc
tatgagtactttgtcattcaggtacaggaagccaacaatgtggagactgctcacaacttc
acagtacctggtaacctccgggctgcagacatcccaggcctcaaggttgccacttcttat
agagtctccatctatggggtagcccggggctatagaacaccagtgctctctgccgagacc
tccacagggacaactcccaatctgggagaggtcactgtggccgaggtgggctgggatgcc
ctcacgctcaactggactgctccagaaggagcctataagaactttttcattcaggtgcta
gaggctgacacgacccagactgtccagaacctcacagtcccaggaggactgaggtcagtg
gacctgcctgggctcaaagcagccacccgctactacatcacccttcgaggggtcacccag
gacttcggcacggcccctctctctgttgaggtcttgacagaggatctccctcagctggga
ggcttgtctgtgactgaggtcagctgggacggcctcacactcaactggaccacagatgac
ctggcctataagcactttgtcgttcaggtgcaggaggccaacaatgtggaggccgctcag
aacctcacggtacccggcagcctcagagctgtggacatcccaggcctcaaggccgacacc
ccttatagagtctccatctacggggtcatccagggctatagaacaccgatgctctctact
gacgtctccacagccagagaacctgaaattggaaacttaaatgtttctgatgtaactcct
aagagcttcaatctctcctggacagctaccgacgggatcttcgacatgtttactattgaa
attattgattctaataggttgctgcaaacagcagaacataatatatctggtgctgaacgg
actgcccacatctcagggcttccacctagtactgatttcattgtctacctctctggaatt
gctcccagcatccgtaccaaaaccatcagtaccacggctaccacagaagctgaaccggaa
gttgacaaccttctagtttcagatgccactccagacggtttccgtctgtcctggactgct
gatgaagggatattcgacagttttgttatcaggatcagagataccaaaaagcaatctgag
ccacaagaaatatccctcccttcccccgaacgtaccagggacataacaggtctcagagag
gccactgagtacgaaattgaactctatggaataagccgcggaaggcgatcccagccagtc
agtgccatagcaacaacagccatgggttctccgaaggaaatcatgttctcagacatcact
gaaaatgcagccacagtcagctggagggcacctactgctcaggtggagagtttccggatc
acttatgtacctatgacaggaggtgccccgtccatggtgactgtggatggaacagatact
gagaccaggctggtgaagcttaccccgggtgtagagtaccgcgtcagtgtgattgccatg
aagggattcgaagaaagcgatccagtctcggggactctaatcacagctctggatggtcca
tctggtcttctgatagccaacatcacagactcagaagccttggccatgtggcagccagcc
attgccactgtggacagttatgtcatctcctacacaggggagagagtgccagaagttaca
cgcacagtgtctggaaatacagtggagtacgagctgcatgacctggagcctgccacagag
tacatcctgagtatctttgcagagaaaggacagcagaagagctctaccatcgccaccaag
tttaccacagacctcgattccccaagagaatttacagctacagaggttcagtcagaaact
gccctccttacctggagacctccccgagcatcggtcactggatacctcctggtctatgaa
tctgtggatggtacagtcaaggaagtcattgtggggcctgacaccacctcctacagcctg
gcagacctgagcccatccacccactactcagcaaggatccaggcattgagtgggtccctg
aggagcaagctgatccaaaccatcttcacaacaattggactcctgtacccattccccagg
gactgctctcaagcaatgttgaatggtgatactacctctggcctctacaccatctatata
aatggtgacaagactcaagcactggaagtctactgtgatatgacctctgatggaggtgga
tggattgttttcctgagacgcaaaaatggacgtgaggacttctatcgcaactggaaggcc
tatgctgctgggtttggagaccgcagagaagaattttggcttggactggataacctgagc
aaaatcacagcccaagggcagtatgagctccgggtggacctacaagaccatggggagtct
gcctatgctgtgtacgacagattcagtgttggagatgccaagagtcgctacaagctgaag
gtagaaggatacagtggaacagcaggtgactccatgaactatcacaatggtagatccttc
tccacctatgacaaggacacagactcagccatcaccaactgtgccctgtcctacaaagga
gctttctggtataagaactgtcatcgtgtcaacctgatgggcagatatggggacaataac
cacagtcagggcgttaactggttccattggaagggccatgagtactcaatccagtttgct
gagatgaaactgagacccagcaacttccgaaatctggaaggcaggcgtaagcgggcataa

DBGET integrated database retrieval system