KEGG   Mus musculus (mouse): 21923
Entry
21923             CDS       T01002                                 

Gene name
Tnc, AI528729, C130033P17Rik, Hxb, T, TN, TN-, TN-C, Ten, cytota, cytotactin, tenas, tenascin-C
Definition
(RefSeq) tenascin C
  KO
K06252  tenascin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21923 (Tnc)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21923 (Tnc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21923 (Tnc)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    21923 (Tnc)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21923 (Tnc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21923 (Tnc)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21923 (Tnc)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_2 EGF_Tenascin EGF Pur_ac_phosph_N DUF2369 fn3_2 hEGF Interfer-bind DUF4998
Other DBs
NCBI-GeneID: 21923
NCBI-ProteinID: NP_035737
MGI: 101922
Ensembl: ENSMUSG00000028364
Vega: OTTMUSG00000000302
UniProt: Q80YX1 Q148T5 Q8C9Z1
Position
4 C1; 4 34.06 cM
AA seq 2019 aa
MGAVTWLLPGIFLALFALTPEGGVLKKIIRHKRESGLNMTLPEENQPVVFNHIYNIKLPM
GSQCSVDLESASGEKDLTPTPESSGSFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELELLVSSLREQCTMGTGCCLQPAEGRLDTRPFCSGRGNFSAEGCGCVCEPGW
KGPNCSEPDCPGNCNLRGQCLDGQCICDEGFTGEDCSQLACPNDCNDQGRCVNGVCVCFE
GYAGPDCGLEVCPVPCSEEHGMCVDGRCVCKDGFAGEDCNEPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGELTCPNDCQGRGQCEEGQ
CVCNEGFAGADCSEKRCPADCHHRGRCLNGQCECDDGFTGADCGDLQCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQRRCPNDCHNRGLCVQGKCICEQGFKGFDCSEMSCPNDCHQHGRC
VNGMCICDDDYTGEDCRDRRCPRDCSQRGRCVDGQCICEDGFTGPDCAELSCPSDCHGHG
RCVNGQCICHEGFTGKDCKEQRCPSDCHGQGRCEDGQCICHEGFTGLDCGQRSCPNDCSN
QGQCVSGRCICNEGYTGIDCSEVSPPKDLIVTEVTEETVNLAWDNEMRVTEYLIMYTPTH
ADGLEMQFRVPGDQTSTTIRELEPGVEYFIRVFAILENKRSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKKVTTTRLDAPSHIEVKDVTDTTALITWFKPLAEIDSIELSYGIK
DVPGDRTTIDLTHEDNQYSIGNLRPDTEYEVSLISRRVDMASNPAKETFITGLDAPRNLR
RVSQTDNSITLEWRNVKADIDSYRIKYAPISGGDHAEIDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKGDKESDPATINAATEIDAPKDLRVSETTQDSLTFFWTTPLAKFDRYRLNYS
LPTGQSMEVQLPKDATSHVLTDLEPGQEYTVLLIAEKGRHKSKPARVKASTEEVPSLENL
TVTEAGWDGLRLNWTADDLAYEYFVIQVQEANNVETAHNFTVPGNLRAADIPGLKVATSY
RVSIYGVARGYRTPVLSAETSTGTTPNLGEVTVAEVGWDALTLNWTAPEGAYKNFFIQVL
EADTTQTVQNLTVPGGLRSVDLPGLKAATRYYITLRGVTQDFGTAPLSVEVLTEDLPQLG
GLSVTEVSWDGLTLNWTTDDLAYKHFVVQVQEANNVEAAQNLTVPGSLRAVDIPGLKADT
PYRVSIYGVIQGYRTPMLSTDVSTAREPEIGNLNVSDVTPKSFNLSWTATDGIFDMFTIE
IIDSNRLLQTAEHNISGAERTAHISGLPPSTDFIVYLSGIAPSIRTKTISTTATTEAEPE
VDNLLVSDATPDGFRLSWTADEGIFDSFVIRIRDTKKQSEPQEISLPSPERTRDITGLRE
ATEYEIELYGISRGRRSQPVSAIATTAMGSPKEIMFSDITENAATVSWRAPTAQVESFRI
TYVPMTGGAPSMVTVDGTDTETRLVKLTPGVEYRVSVIAMKGFEESDPVSGTLITALDGP
SGLLIANITDSEALAMWQPAIATVDSYVISYTGERVPEVTRTVSGNTVEYELHDLEPATE
YILSIFAEKGQQKSSTIATKFTTDLDSPREFTATEVQSETALLTWRPPRASVTGYLLVYE
SVDGTVKEVIVGPDTTSYSLADLSPSTHYSARIQALSGSLRSKLIQTIFTTIGLLYPFPR
DCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKA
YAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLK
VEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNN
HSQGVNWFHWKGHEYSIQFAEMKLRPSNFRNLEGRRKRA
NT seq 6060 nt   +upstreamnt  +downstreamnt
atgggggccgtgacctggctactgccaggcatctttctagctttgtttgccctcactccc
gaaggtggggtcctcaagaaaatcatcaggcacaagcgagagagtgggctaaacatgacc
ctgccagaagagaatcagccagtggtgttcaaccatatctacaacatcaagttgcccatg
ggttcccaatgctcagtggatctggagtcagcgagtggggagaaagacctgacccccacg
ccagagtccagtgggagcttccaggaacatacagtggatggggaaaaccaaattgtattc
acacaccgcatcaacatcccccgccgggcctgtggctgtgctgcagctccagatgtgaag
gagctcctgagcaggctggaggagctggagttgctggtatcgtctctaagggagcagtgc
accatgggtacaggctgttgcctccaacctgcagaaggtcgtctggacaccaggcccttc
tgcagcggacggggcaacttcagtgcagaaggctgcggctgtgtctgtgaaccaggctgg
aaaggccccaactgctctgagcctgactgccctgggaactgtaatctcagaggccagtgc
cttgacggccagtgtatctgtgacgagggtttcactggggaagactgcagccagctggcc
tgtccgaacgactgcaatgaccagggcaggtgtgtgaacggggtctgtgtgtgcttcgaa
ggctatgccggccctgactgtggcctggaagtctgcccagtgccctgcagcgaggaacac
gggatgtgtgtggatggcaggtgtgtgtgcaaagatggctttgcgggtgaggactgcaac
gagcccctttgcctcaacaactgctacaatcgtgggcggtgtgtggagaacgagtgtgtc
tgcgacgagggcttcactggcgaggactgcagtgagctcatttgccccaacgactgcttc
gaccgcggtcgctgcatcaatggcacctgctactgtgaagaaggtttcacgggcgaagac
tgcggtgagctcacctgccccaacgactgtcagggccgtggccagtgtgaggagggacag
tgtgtttgcaacgagggctttgcaggagcagactgcagtgaaaagcggtgtcccgccgat
tgtcaccaccgtggccgctgcctcaacgggcagtgtgagtgtgacgatgggttcacaggg
gctgactgtggggatctccagtgtcccaatggctgcagtgggcatggccgttgtgtcaac
gggcagtgcgtgtgtgacgagggctataccggagaagactgtagccagcggcgatgcccc
aatgactgtcacaaccggggtctctgcgtacagggcaagtgcatatgtgaacaaggcttc
aagggctttgactgtagtgagatgagctgtcccaatgactgccaccaacatggccgctgt
gtgaatggcatgtgtatctgtgatgacgactacactggggaagactgcagagaccggcgc
tgtccccgggactgtagccagcgggggcgctgtgtagacggacagtgcatctgtgaggat
ggcttcactggccctgactgtgctgagctttcctgccccagtgactgccacggccatggc
cgctgtgtgaatggccaatgcatctgccacgagggcttcactggcaaagactgcaaagag
caaaggtgccccagtgattgccatggccaaggccgctgtgaggacggccagtgtatctgc
catgagggctttacgggcctggactgtgggcagcgctcctgtcccaatgactgcagcaac
caaggacaatgtgtgtcaggccgctgcatctgcaatgaaggttacacagggatagactgc
tctgaggtgtcccctcccaaagaccttattgtgacagaagtaacagaggagactgtaaat
ctggcatgggacaatgagatgcgggtcactgagtacctcattatgtacacacccacccat
gctgatggcctagagatgcagttccgtgtgcctggggaccagacatccaccaccattcgg
gagctggaaccaggggtggagtacttcattcgtgtgttcgccatcttggaaaacaagagg
agcatccctgtcagtgccagggttgccacctatttgcctgcacctgaaggtctaaaattc
aagtctatcaaggagacatctgtggaagtagagtgggatcctctagacattgctttcgaa
acatgggagatcattttccgaaatatgaacaaagaagatgagggagagatcacaaaaagt
ctgaggagaccagagacctcctaccgccaaactggccttgctcctggccaagagtatgaa
atatctctgcacattgtgaaaaacaacacccgaggccccggcttgaagaaagtaaccaca
acccgcctggatgcccccagccatattgaggtgaaagatgtcacagacaccacagcactg
atcacctggttcaagcccttggctgaaattgatagcattgagctctcctatggcatcaag
gatgtacctggagaccgtaccaccatcgacctcacacacgaagacaaccagtactccatc
gggaacctgagacctgacacggagtatgaggtgtccctcatctcccgcagagtggacatg
gcaagcaaccctgccaaagagaccttcatcacaggcctggatgctcccaggaatctccgc
cgtgtctcacagacagacaacagcatcaccttggagtggaggaacgtcaaggcagacatc
gacagttacagaattaagtatgcccctatctctggaggtgaccatgctgagatagatgtt
ccaaagagccagcaagccacaaccaaaaccacactcacaggtctaaggcccggaactgaa
tatgggattggtgtttctgctgtcaagggagacaaggagagtgatccagcaaccatcaat
gcggccacagaaattgatgcacccaaggacttacgggtgtctgaaaccacacaagacagt
ctgacgtttttctggacgacacccctggccaagtttgatcgttaccgcctcaactacagc
ctccccacaggccagtcgatggaagtccagctgccaaaggatgccacctcccatgtcctg
acagacctggagccagggcaagaatacactgttctcctcattgctgagaagggcagacac
aagagcaagcctgcacgtgtgaaggcatccacggaagaagtgccttccctggaaaatctc
actgtgactgaggccggctgggatggcctcagactcaactggactgcagatgacctggcc
tatgagtactttgtcattcaggtacaggaagccaacaatgtggagactgctcacaacttc
acagtacctggtaacctccgggctgcagacatcccaggcctcaaggttgccacttcttat
agagtctccatctatggggtagcccggggctatagaacaccagtgctctctgccgagacc
tccacagggacaactcccaatctgggagaggtcactgtggccgaggtgggctgggatgcc
ctcacgctcaactggactgctccagaaggagcctataagaactttttcattcaggtgcta
gaggctgacacgacccagactgtccagaacctcacagtcccaggaggactgaggtcagtg
gacctgcctgggctcaaagcagccacccgctactacatcacccttcgaggggtcacccag
gacttcggcacggcccctctctctgttgaggtcttgacagaggatctccctcagctggga
ggcttgtctgtgactgaggtcagctgggacggcctcacactcaactggaccacagatgac
ctggcctataagcactttgtcgttcaggtgcaggaggccaacaatgtggaggccgctcag
aacctcacggtacccggcagcctcagagctgtggacatcccaggcctcaaggccgacacc
ccttatagagtctccatctacggggtcatccagggctatagaacaccgatgctctctact
gacgtctccacagccagagaacctgaaattggaaacttaaatgtttctgatgtaactcct
aagagcttcaatctctcctggacagctaccgacgggatcttcgacatgtttactattgaa
attattgattctaataggttgctgcaaacagcagaacataatatatctggtgctgaacgg
actgcccacatctcagggcttccacctagtactgatttcattgtctacctctctggaatt
gctcccagcatccgtaccaaaaccatcagtaccacggctaccacagaagctgaaccggaa
gttgacaaccttctagtttcagatgccactccagacggtttccgtctgtcctggactgct
gatgaagggatattcgacagttttgttatcaggatcagagataccaaaaagcaatctgag
ccacaagaaatatccctcccttcccccgaacgtaccagggacataacaggtctcagagag
gccactgagtacgaaattgaactctatggaataagccgcggaaggcgatcccagccagtc
agtgccatagcaacaacagccatgggttctccgaaggaaatcatgttctcagacatcact
gaaaatgcagccacagtcagctggagggcacctactgctcaggtggagagtttccggatc
acttatgtacctatgacaggaggtgccccgtccatggtgactgtggatggaacagatact
gagaccaggctggtgaagcttaccccgggtgtagagtaccgcgtcagtgtgattgccatg
aagggattcgaagaaagcgatccagtctcggggactctaatcacagctctggatggtcca
tctggtcttctgatagccaacatcacagactcagaagccttggccatgtggcagccagcc
attgccactgtggacagttatgtcatctcctacacaggggagagagtgccagaagttaca
cgcacagtgtctggaaatacagtggagtacgagctgcatgacctggagcctgccacagag
tacatcctgagtatctttgcagagaaaggacagcagaagagctctaccatcgccaccaag
tttaccacagacctcgattccccaagagaatttacagctacagaggttcagtcagaaact
gccctccttacctggagacctccccgagcatcggtcactggatacctcctggtctatgaa
tctgtggatggtacagtcaaggaagtcattgtggggcctgacaccacctcctacagcctg
gcagacctgagcccatccacccactactcagcaaggatccaggcattgagtgggtccctg
aggagcaagctgatccaaaccatcttcacaacaattggactcctgtacccattccccagg
gactgctctcaagcaatgttgaatggtgatactacctctggcctctacaccatctatata
aatggtgacaagactcaagcactggaagtctactgtgatatgacctctgatggaggtgga
tggattgttttcctgagacgcaaaaatggacgtgaggacttctatcgcaactggaaggcc
tatgctgctgggtttggagaccgcagagaagaattttggcttggactggataacctgagc
aaaatcacagcccaagggcagtatgagctccgggtggacctacaagaccatggggagtct
gcctatgctgtgtacgacagattcagtgttggagatgccaagagtcgctacaagctgaag
gtagaaggatacagtggaacagcaggtgactccatgaactatcacaatggtagatccttc
tccacctatgacaaggacacagactcagccatcaccaactgtgccctgtcctacaaagga
gctttctggtataagaactgtcatcgtgtcaacctgatgggcagatatggggacaataac
cacagtcagggcgttaactggttccattggaagggccatgagtactcaatccagtttgct
gagatgaaactgagacccagcaacttccgaaatctggaaggcaggcgtaagcgggcataa

KEGG   Mus musculus (mouse): 21960
Entry
21960             CDS       T01002                                 

Gene name
Tnr, J1-ten, J1-tenascin, TN, TN-R, ja, janusin, rest, restrictin
Definition
(RefSeq) tenascin R
  KO
K06252  tenascin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21960 (Tnr)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21960 (Tnr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21960 (Tnr)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    21960 (Tnr)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21960 (Tnr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21960 (Tnr)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21960 (Tnr)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_Tenascin EGF_2 Tissue_fac EGF TolA_bind_tri
Other DBs
NCBI-GeneID: 21960
NCBI-ProteinID: NP_071707
MGI: 99516
Ensembl: ENSMUSG00000015829
Vega: OTTMUSG00000050612
UniProt: Q8BYI9
Position
1; 1 H1
AA seq 1358 aa
MGIDGETVVLKNMLIGVNLILLGSMLKPSECRLEVTTERAQRQTVEEEGGASSYNTSSKE
QPMVFNHVYNINVPLESLCSSGLEASAEQDMSAEDDTLAEYIGQTSDHESQVTFTHKINL
PKKACPCASSSQVLQELLSRIEMLEREVSLLRDQCNTNCCQESAATGQLDYVPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGQCANGTCLCQEGYAGEDCSQRRCLNA
CSGRGHCQEGLCICEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTIMELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQLPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWTPPRAKVDFILLKYGL
VGGEGGKTTFRLQPPLSQYSVQALRPGSRYEVSISAVRGTNESEASSTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEAQEYKVVYSTLAGEQYHEVLVPKGIGPTTKTTLTDLVPGT
EYGVGISAVMNSKQSIPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGISSEVTVPRDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDKEEDMLEVLLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKNITISNVTKDSLTVSWSSPVAPFDYYRVSYRP
TQVGRLDSSVVPNTVTEFAITRLYPATEYEISLNSVRGREESERICTLVHTAMDSPMDLI
ATNITPTEALLQWKAPMGEVENYVIVLTHFAIAGETILVDGVSEEFQLVDLLPSTHYTVT
MYATSGPLMSGTIATNFSTLLDPPDNLTASEVTRQSALISWQPPRAAIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLSENTDYTVLLQAAQEATRSSLTSTVFTTGGRVFSHPQDCAQ
HLMNGDTLSGVYTIFLNGELSHKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNLEDEFWLGLDNIHRITAQGRYELRVDMRDGQEAVFAYYDKFAVEDSRSLYKIRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYIHRLTAGRKRRALKF
NT seq 4077 nt   +upstreamnt  +downstreamnt
atggggatcgatggggaaacagtagtcttgaagaacatgctcattggtgtaaacctgatc
ctgttgggatccatgctcaagccttctgagtgtcggctggaggtgactacagaaagggct
cagagacaaactgtggaggaggaaggaggggcttccagctacaatacttccagcaaggaa
cagcctatggtcttcaaccatgtgtataacatcaacgtgccacttgaaagcctctgctcc
tcggggctggaggcctcagctgagcaggacatgagtgctgaagatgatactctggccgaa
tacataggccaaacctcagaccatgaaagccaggttaccttcacccacaagatcaacctc
cccaaaaaagcctgcccatgtgcaagctcttcccaggtactgcaggaactgctgagccgg
atcgagatgctggagagggaggtgtccttgctgcgagaccagtgcaataccaactgctgt
caggaaagcgctgccacaggacaactggactatgtccctcactgcagcggccatggcaac
tttagcttcgagtcctgtggctgcatctgcaatgaaggctggtttggcaagaactgctca
gagccctactgcccactgggctgctccagtcggggtgtgtgtgtcgatggccagtgcatt
tgtgacagtgaatacagcggagatgactgttcagagctccggtgcccaacagactgcagt
tcccgagggctctgtgtggatggggaatgtgtctgtgaagagccctacacaggcgaggac
tgcagggagctgcgctgccctggggactgttcagggaaggggcaatgtgccaatggtacc
tgcctgtgccaagagggctatgctggtgaggactgcagccagcgacggtgtctgaatgcc
tgcagtgggcgaggtcactgccaggaggggctctgcatctgtgaggaaggctaccagggc
cctgactgctcagcagttgcccctccagaggacttgcgagtggctggtatcagcgacagg
tccattgagctggaatgggacgggccgatggcagtgacggaatatgtgatctcttaccag
ccgacggccctggggggccttcagctccagcagcgggtgcctggagattggagtggtgtc
accatcatggagctggagccaggtctcacctacaacatcagcgtctacgctgtcattagc
aacatcctcagccttcccatcactgccaaggtggccactcatctctccactcctcaaggg
ctacagttcaagacgatcacagagaccaccgtggaggtgcagtgggagcccttctctttc
tccttcgacgggtgggagatcagcttcattccaaagaacaatgaaggaggggtgattgct
cagctccccagcgatgtgacgtcctttaaccagacaggactgaaacctggggaggagtac
attgtgaatgttgtggctctaaaggaacaagcccggagccctcctacctctgccagcgtc
tccactgtcattgacgggcccacacagatcctggttcgagatgtctctgatactgtggct
tttgtggaatggaccccacctcgagccaaagttgatttcattcttttaaaatatggcttg
gtgggtggcgaaggcgggaagacgaccttccggctgcagcctcccttaagccagtactcc
gtgcaagcccttagacctggctcgcgctacgaggtgtccatcagcgcagtccgggggacc
aatgagagtgaagcctcaagcacccaatttacaacagagattgatgctcccaagaatttg
cgagtgggttcccgcacagcaactagccttgacctggaatgggataacagcgaggccgaa
gctcaggagtacaaggttgtgtacagcaccttagctggtgaacagtaccacgaagtgctg
gtacccaagggcattggcccaactaccaagactaccctcacagatctggttccaggcaca
gagtatggagttggaatatctgcagtaatgaactcaaaacaaagcattcctgccactatg
aatgccaggactgaacttgacagtccccgagacctcatggtaacagcctcctcagagacc
tctatctctctcatctggaccaaggccagtggtcccattgatcactacagaattactttt
accccatcttctgggatctcctccgaagtcactgtgcccagggataggacttcatacaca
ctaacagatctagagcctggagcagaatacattatctccatcactgctgagaggggtcgg
cagcagagcctggagtctactgtggatgccttcacaggcttccgccctatctcccatttg
cacttttctcatgtgacctcctccagtgtcaatatcacctggagtgacccatctccccca
gcagacagactcattctgaactacagccccagggacaaagaggaagacatgttggaggtc
ctcttggatgccaccaagaggcacgctgtcttgatgggtctacagccagccactgaatat
atagtgaaccttgtagctgtccatgggacggtaacctctgaacccatagtgggttctatc
actacaggaattgatcctcccaaaaacatcacaattagcaacgtgactaaggactccctg
acggtgtcctggagctctcctgttgcgccttttgattactaccgagtatcgtaccgaccc
acccaagtgggacggctagacagctccgtagtgcccaacaccgtgacagagttcgccatc
accaggctgtatccagctactgaatatgaaataagcctcaacagtgtacggggcagggag
gagagtgaacgcatctgcaccctggtgcacacagccatggatagccccatggatttgatc
gctaccaacatcacacctacagaagccttgctccagtggaaagcacccatgggtgaagtg
gaaaattatgtcatcgtcctcacacactttgcaattgctggagagaccatcctggttgac
ggggtcagcgaagaattccagcttgtagacttgcttcctagcacccactacactgtcact
atgtatgccaccagtgggcctctcatgagtggcaccattgccaccaacttctccaccctc
ctggaccctcctgacaacctgacagccagtgaagtcaccaggcaaagcgcactgatctcc
tggcagccgcccagagctgcgattgaaaactatgtcttgacatacaagtccaccgatgga
agccgcaaagagctgatagtggatgctgaggacacctggatccgactagagggcctgtca
gagaacacagactacacagtgctcctgcaggcagcccaggaggccacaaggagcagtctc
acctctactgtctttaccacagggggccgggtgttctctcatcctcaagactgtgcccag
catttgatgaatggagacactctgagtggcgtttacaccatcttcctcaatggggagcta
agccacaagctgcaagtgtactgtgacatgaccacagatgggggcggctggattgtattc
cagaggcggcaaaatggacaaactgattttttccggaaatgggcagattatcgtgttggc
tttgggaatctggaggatgagttttggctagggctagacaacatccacaggataacagcc
cagggccgctatgagctgcgtgtggatatgcgggatggacaggaagcagtctttgcctac
tatgacaagttcgctgtggaggacagcagaagcctgtacaagatccgcataggaagttac
aatggcactgcaggagactccctcagctatcaccagggacgtcctttctccactgaggac
agagacaatgatgttgcagtcaccaactgtgccatgtcctacaagggtgcttggtggtat
aagaactgccaccggaccaacctcaacgggaagtacggggagtccaggcacagtcagggg
atcaactggtaccattggaaaggccatgaattctccatcccctttgtagaaatgaagatg
aggccctacatccatcgtctcacagccgggaggaaacggcgagccttgaaattctga

KEGG   Mus musculus (mouse): 329278
Entry
329278            CDS       T01002                                 

Gene name
Tnn, TN-W, Tn, Tnw, tenas, tenascin-W
Definition
(RefSeq) tenascin N
  KO
K06252  tenascin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    329278 (Tnn)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    329278 (Tnn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    329278 (Tnn)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    329278 (Tnn)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    329278 (Tnn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    329278 (Tnn)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   329278 (Tnn)
SSDB
Motif
Pfam: fn3 Fibrinogen_C DUF4998 Interfer-bind Pur_ac_phosph_N DUF4959 EGF_2 EGF_Tenascin Wtap Ax_dynein_light
Other DBs
NCBI-GeneID: 329278
NCBI-ProteinID: NP_808507
MGI: 2665790
Ensembl: ENSMUSG00000026725
Vega: OTTMUSG00000025412
UniProt: Q80Z71
Position
1; 1 H2.1
AA seq 1560 aa
MGLWGMLAFPLGFLLASVLLVASAPATPESPGCSNKEQQVTVSHTYKIDVPKSALVQVET
DPQSLSDDGTSLLAPGEDGEEQNIIFRHNIRLQTPQKNCDLADSVQDLLARMKKLEEEMA
ELKEQCNTNRCCQGAADLSRHCSGHGTFLPETCSCHCDQGWEGADCDQPTCPGACNGHGR
CVDGQCVCDAPYVGVDCAYAACPQDCSGHGVCVQGVCQCHEDFTAEDCSEQRCPGDCSGN
GFCDTGECYCEMGFTGPDCSQVVAPQGLQLLKSTENSLLVSWEPSSEVDYYLLSYYPLGK
EQATKQVRVPKEQHTYDITGLLPGTKYIVTLRNVKKDISSSPQHLLATTDLAVVGTAWVN
EETETSLDVEWENPLTEVDYYKLRYGPLTGQEVTEVTVPKSRDPKSRYDITGLQPGTEYK
ITVVPIRGDLEGKPILLNGRTEIDGPTNVVTNQVTEDTASVSWDPVRADIDKYVVRYIAP
DGETKEKAVPKDQSSTVLTGLKPGEAYKVFVWAERGNQGSKKADTKALTEIDSPENLVTD
RVTENSLSVSWDPVEADIDRYVVSYTSVDGETKQVPVKKDQRSTVLTGLSPGVEYKVYVW
AEKGDRESKKANTKAPTDIDSPKNLVTDQVTENTLSVSWDPVQANIDRYMVSYTSADGET
REVPVPKEKSSTVLTGLRPGVEYKVHVWAQKGTQESRKANTKAPTDIDGPKNLVTDQVTE
TTLSVSWDPVEADIDRYMVRYTSPDGETKEVPVSKDKSSTVLRGLRPGVEYKVDVWAQKG
AQDSRKANTKAPTDIDSPKNLVTEQVTESTATVSWDPVEADIDRYVVRYTSVDGETREFL
VGKDQTSTVLTGMRPGVEYQVDVWAQKGTQESRKTSTKAPTDIDGPKNLVTDQVTETTLS
VSWDPVEADIDRYMVRYTSPDGETKEVPVSKDKSSTVLRGLRPGVEYKVDVWAQKGAQDS
RKANTKAPTDIDSPKNLAIDQVTETTLSVSWDPVQADIDRYVVRYTSADGESKEFLIGKE
QRSTVLTGLRPGVEYKVEVWAQKGARESKKANTEGHTDIDSPKNLVTNQVTENTATISWD
PVQADIDRYMVRYTSADGETREIPVRKEKSSTVLTGLRPGVEYTVQVWAQKGARESKKAK
TKAPTEIDSPKNLVTNRVTENTATISWDPVRANIDRYMVRYTSADGETKEIPVSKDQSST
ILTGLKPGMEYTIHVWAQKGARESKKADTKALTEIDPPRNLRPFGVTHSGGVLTWLPPSA
QIDGYILTYQFPNGTVKEVELPRGQQRFELQDLEQGVTYPVSLVAFKGNQRSRTVSTTLS
TVDARFPHPSDCSQVQQNTNAASGLYTIYLNGDASRPMQVYCDMDTDGGGWIVFQRRNTG
QLDFFKRWRSYVEGFGDPMKEFWLGLDKLHNLTTGTTTRYEVRADLQTFNESAYAVYDFF
QVASSKERYKLSVGKYRGTAGDALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCH
LANPNGKYGETKHSEGVNWEPWKGHEFSIPYVELKIRPFGYSRDRFSGRKKRSIGKARMF
NT seq 4683 nt   +upstreamnt  +downstreamnt
atgggtctctgggggatgctcgccttccccctgggatttctgcttgcttctgtgctcctg
gtggcttcggccccagccactccagagtctcccggctgcagcaacaaagagcaacaggtc
actgttagccacacctacaagattgacgtgcccaagtctgctctggttcaagtagagacc
gacccacagtcactcagcgatgatgggacatcactcttggctcccggggaggatggggag
gagcagaacattatcttcaggcacaacatccgtcttcagacaccgcagaagaattgcgac
ctggcagacagtgtccaggacctgctagcccggatgaaaaagctggaggaagagatggca
gagctgaaggagcagtgcaataccaaccgctgctgccagggggctgctgatctgagccgt
cactgcagtggccacgggaccttcctccctgagacctgcagctgccactgtgaccagggc
tgggagggcgcagactgtgatcagcccacctgtcctggggcttgcaacggccacgggcgc
tgtgtggatgggcagtgcgtgtgtgacgcgccctatgtgggggtcgactgcgcctacgcc
gcctgtccccaggactgcagtgggcatggcgtgtgcgtgcagggtgtctgccagtgccac
gaggacttcacagcagaggactgcagcgagcagcgctgtcctggcgactgtagtggcaat
ggtttctgtgacactggcgagtgttactgtgagatgggctttactggccccgactgttcc
caggtggtggctcctcagggcctgcagttgctcaagagcacggagaactctctgctggtg
agttgggagccctccagtgaggtagactactacctgctcagctactaccccctggggaag
gagcaagctacaaaacaggtccgggtacccaaggagcagcacacctatgacatcaccggc
ttgctgcctggaaccaagtacatagtcaccctgcgcaacgtgaagaaagacatttccagc
agccctcagcatctacttgccaccacagatcttgctgtggtgggcacagcctgggtaaat
gaagagactgagacatccctcgatgtggagtgggagaaccctctgactgaggtggactat
tacaagcttcggtatggccccttaacagggcaggaggtgacagaggtcactgtgcccaag
agccgtgatcccaagagcagatatgacatcactggtctgcagcctggaacggaatataaa
atcacagttgtgcccatccgaggtgatctggagggaaagccgattctcctgaatggcagg
acagaaattgatggaccaaccaatgtggtcacaaatcaggtgacagaagacacagcatct
gtttcctgggatccagtgagggctgacatagacaagtatgtggtgcgctatatcgccccc
gatggggagaccaaggagaaggcagtaccaaaggaccagagcagcaccgttctcacaggc
ctgaagccaggagaggcctacaaagtctttgtgtgggctgagaggggcaaccaaggcagc
aagaaagcagacaccaaggccctcacagaaattgacagtccagaaaacctggtgactgac
cgggtgacagagaacagcctctctgtctcgtgggacccagtggaggctgacatcgacagg
tatgtggtaagctacacttccgtggatggagagacgaagcaggttccagtgaagaaggac
cagaggagcaccgtcctcaccggcctgagtcccggtgtggagtacaaagtttacgtgtgg
gcagagaaaggcgatcgggagagcaagaaggccaacaccaaggctcccacagacatcgac
agccccaaaaacttggtaactgaccaggtgacagagaacactctcagtgtctcctgggac
cctgttcaggccaacattgacaggtatatggtgagctacacctctgccgatggagagaca
agagaggtcccagtgcctaaggagaagagcagtaccgtcctgactggcctgaggccaggt
gtggagtacaaggtccatgtgtgggcccagaaggggacccaggagagcagaaaggccaac
accaaggcccccacagatattgatggccccaaaaacctggtgactgaccaggtgaccgag
accactcttagtgtctcctgggacccagtggaggctgacattgataggtacatggttcgc
tacacgtctcctgatggagagaccaaggaggtgcctgtgtcaaaggataagagcagcaca
gtcctgaggggcctgaggccaggtgtggagtacaaggtggatgtatgggcccagaagggg
gcccaggacagccggaaggccaacaccaaggcccccacagatattgacagccctaaaaac
ctggtgactgagcaggtgacagagagcactgccaccgtgtcctgggacccagtagaggct
gacatcgacaggtatgtggtgcgctacacttctgtcgatggcgagaccagggaatttctc
gttgggaaggaccaaacaagcaccgtcctgacaggcatgagaccaggtgtggagtatcag
gtcgacgtgtgggcccagaaggggacacaggaaagcaggaagaccagcaccaaagcccca
acagatattgatggccccaaaaacctggtgactgaccaggtgaccgagaccactcttagt
gtctcctgggacccagtggaggctgacattgataggtacatggttcgctacacgtctcct
gatggagagaccaaggaggtgcctgtgtcaaaggataagagcagcacagtcctgaggggc
ctgaggccaggtgtggagtacaaggtggatgtatgggcccagaagggggcccaggacagc
cggaaggccaacaccaaggcccccacagatattgatagtcccaaaaacctggcgatcgac
caggtgacagagaccactctcagtgtctcctgggacccagtacaggctgacattgacagg
tatgtggtgcgctacacctctgctgatggggaatccaaagaattcctgattgggaaggaa
cagaggagcacagtcctgacaggcctgaggccaggtgtggagtacaaggttgaagtgtgg
gcccagaaaggagcccgggagagcaagaaagccaacaccgaaggtcacacagacattgac
agccccaaaaacctggtgaccaatcaggtgaccgaaaatacagccaccatctcctgggac
ccggtgcaggctgatattgacagatacatggtgcgctacacatctgctgatggagagacc
agggagattccagtgaggaaggagaagagcagcactgtcctcacaggcctgagaccgggt
gtggagtacacggtccaagtgtgggctcagaagggggcccgggagagcaagaaggccaaa
accaaggcccccacagaaattgacagccccaagaacttggtgaccaaccgagtgacagaa
aatacagccaccatctcctgggacccagtgcgagccaacattgacaggtacatggttcgc
tacacctctgcggatggagagactaaggagattccagtgtcaaaggatcagagtagcacc
atcctgacaggcctgaaaccaggcatggaatataccattcatgtgtgggcccagaagggg
gcccgggagagcaagaaggctgataccaaggccctaacagaaattgaccctcccagaaat
ctccgtccgttcggggtaacacattctggtggggttttgacctggttgcccccatctgct
caaattgatggctacattttgacctaccagttcccaaatggcaccgtgaaggaggtggag
ctcccaagaggccagcagagatttgaattgcaagacctggaacagggtgtcacctatcct
gtttccttggttgccttcaaaggtaatcagcggagccggactgtgtctaccaccctttct
acagtggatgctcgctttccacacccctcagactgcagtcaagttcagcagaacaccaac
gctgccagtgggctctacaccatctacctcaatggtgatgccagccggcccatgcaggtg
tactgcgacatggacactgacggaggcggctggattgtcttccagagacggaacactggg
cagctggatttcttcaagcgttggcggagttatgtagaaggttttggggaccccatgaag
gagttctggcttggacttgataaactacataatctcaccactggcaccaccactcggtat
gaggtgagggcagacttacagactttcaatgaatctgcctacgctgtatatgatttcttc
caagtggcatccagcaaagagcggtacaagctgtcggttgggaaatacagaggcacagcc
ggggatgctctcacctaccacaatggatggaagttcacgacttttgacagagacaatgat
attgccctcagcaactgtgcactgacgcatcatggtggctggtggtataagaactgccat
ttggccaacccgaatggcaaatatggggagaccaagcacagcgagggggtgaactgggag
ccatggaagggacatgagttctccattccttatgtggagctgaaaatccgcccgtttggt
tacagcagagaccgtttctctggcagaaagaagcgctccataggaaaagcaaggatgttc
tga

KEGG   Mus musculus (mouse): 81877
Entry
81877             CDS       T01002                                 

Gene name
Tnxb, TN-MH, Tn, Tn-mhc, Tnx
Definition
(RefSeq) tenascin XB
  KO
K06252  tenascin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    81877 (Tnxb)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    81877 (Tnxb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    81877 (Tnxb)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    81877 (Tnxb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    81877 (Tnxb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    81877 (Tnxb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   81877 (Tnxb)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_2 EGF_Tenascin DUF2369 DUF4998 fn3_2 DUF4959 hEGF
Other DBs
NCBI-GeneID: 81877
NCBI-ProteinID: NP_112453
MGI: 1932137
Ensembl: ENSMUSG00000033327
Vega: OTTMUSG00000037253
UniProt: E9Q2T3
Position
17 B1; 17 18.24 cM
AA seq 3126 aa
MAAQCTPSILTILVLLGLARAGPFSPRSNVTLPAPRPPPKPGGPSSQLYEHTVEGGEKQV
VFTHRINLPPSAGCGCPPGSEPPVPASEVQALRVRLEILEELVKGLKEHCTGGCCPTAAQ
AGTGQTDVRSLCSLHGVFDLSRCACSCEPGWGGPTCSDPTDTKTPTSSPPSKSCPEDCND
QGRCVRGRCVCFPGYSGPSCSWPSCPGDCQGRGRCVKGVCVCRAGFSGPDCSQRSCPRNC
NQRGRCEEGRCVCDPGYSGEDCGVRSCPRGCSQRGRCENGLCVCNPGYSGEDCGVRNCPR
GCSQRGRCEDGRCVCDPGYSGEDCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTC
PRDCRGRGRCEDGECICDAGYSGDDCGVRSCPGDCNQRGHCEDGRCVCWPGYTGADCSTR
ACPRDCRGRGRCEDGVCVCHAGYSGEDCGVRSCPGDCRGRGNCESGRCVCWPGYTGRDCG
TRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGHCENGVCVCAVGYSGDD
CSTRSCPSDCRGRGQCLNGLCECDEGYSGEDCGIRRCPRDCSQHGVCQDGLCMCHAGYAG
EDCSIRTCPADCRRRGRCEDGRCVCNPGYTGPACATRTCPADCRGRGRCVQGVCMCYVGY
SGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRSRGECIQGR
CVCQEGYAGDDCGEEIPAIQNMRMHLLEETTVRTEWTRAPGPVDAYEIQFIPMTEGVSPP
FTARVPSSASAYDQRGLAPGQDYQVTVRALRGTSWGPPASKTITTMIDGPQDLRVVAVTP
TTLDLSWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADRTQLTDLMPGVEYVVTVTAERG
HAVSYPASIRANTDRAQEQPGKPSVQPRLGELTVTGLTSDSLLLHWTVPEGEFDSFLIQY
KDKDGPQAISVEGPQRSTPISGLEPGRKYKFILYGLIGKKRHGPLMAEAKILIQSDPDPG
SPPRLGELWVTDPTPHSLHLSWTVLGGQFDSFVVQYRDKEGQPRVVPVEGPDRSVVISPL
DPNRKYRFTLFGIANKKRYGPLTADGTTAAETKEESSEPPRLGELTVTGVTPDSLRLSWT
VARGPFDSFVILYKDAQGQPQSVPIEGDENEVTVPGLESNRKYKMNLYGLRGRQRVGPVS
VVAKTAPPDVVDQPLSPPEPSTEAPEPPEKPLLRELIVTDTTPNSLSLSWTVSEGQFDQF
VIQYKNGDGQPKVVRVPGHEDQVTISGLEPDHKYKMNLYGIHSGQRVGPVSVVGVTAAEE
EPPSPTEPSTEAPEPTEEPLLGELTVTGSSPDSLSLSWTVPQGDFDSFTVQYKSSDGRPQ
VMRVGGQEREVIVRDLDPGHKYKMNLYGLHEGHRVGPVSTVGTTDKQPEEKPPLEPRLEE
LTVTGVTPNSVSLSWIVPEGQFDSFVVQYQDRDGQPREVPLTAEQREVTVLDLDPARIYK
MNFYGLHGRRRVGPLSVSAMTAPAPATEASKLLPEPRLGELTVTDVTPDSVGLLWTVPEG
EFDSFTVQYKDRDGQPHVVSVAADLREVTIPGLEPSRKYKFLLFGVQDGKRRSQVSVEAK
TATHDDTSPGAPPRLGELWVTDPTTDSLRLSWTVPEGHFDSFVVQFKDKSGPRVVPVKGQ
ERTATITALDAGRKYRFLLYGLLGRKRFGPLTAEGITEPTNAADHTKSRLGEELRVTGVT
QNSVDLSWTVSEGQFDSFVVQYKDRDGQSQVVPVDGSHREVRVSGLDPGRRYKLLLYGLR
DSKRVGPLSVIAVTDPRETTEAWTEVPTTSTPAAVPRLGELRVEEATPHSLHLSWVVTEG
EFNSFEVQYTDRDGQLRVASTEGDQTDITLTGLESNHRYLITLYGFHDGQPVGSAQIEAL
TVPWEEEEEEEESTEPPTMTPEPRPQLGELTVTDATPDSLSLSWTVPEGQFDQFVIQYKN
GDGQPKVVRVPGHEDQVTISGLEPDHKYKLNLYGIHSGQRFGPVSTVGVTAAVEEPPSPT
EPSIEAPEPTEEPLLGELTVTGSSPDSLSLSWTVPQGDFDSFTVQYKDSDGRPQVMRVGG
QEREVIVRDLDPGRKYKMNLYGLHEGRRVGPVSTVGVTASLTTEPPIEPRLGELAAVEVT
SSTVHLSWTVAQGPFDSFLVQYKDTQGQPQMVPVSGDLGEVTVSGLEPARKYKFLLFGLK
DGKRHGPVSTEAKTVSDAKLLPRLGELTVTDTTQNSVGLSWTVPEGEFDSFLVQYKNRGG
QVQVVPAAADQREVTISSLEPNRKYRFLLFGLIGLKRLGPVSVEGTTAPVEKTPQPRLGE
LSVTEETSDSMHLSWSVAQGPFDSFLVQYKDRDGQLQTVSLAADQREVTIEGLQPGRKYK
FLLYGLTGGKRLGPISALGVTASEVDISAPDHTEPPHAPGLGTLAVTEATPDSLRLSWAV
ARGPFDSFVVQYQDTENETQALLVDGDQDKVLISGLEPKTSYKFFLYGLREGTRHGPVSV
EGTTDPVPAGQGPGDPGPRLSQLSVSDVTTSSLRLNWEAPLGAFDSFLLRFGVPLLSTLE
QNPRTLQQRELMVPGVRRSAMLRDLRPGTLYSLTLYGLRGPHKADSIQGTARTLSPVLES
PRDLQFSDIGETSAKVKWVPPTSRVDSFKISYQLADGGEPQSVQVDGRTQTQILQGLIPD
TRYEVTVVSVRGFEESEPLTGFLTTVPDGPTQLRALNLTDGSALLHWKPPHKPVDKYDVE
VESPGAPPLQASAPGSAVDYPLTDLALDTNYTATVRGLRGPNFTSPASITFTTGLKPPQD
LEAKEVTPRTALLTWTEPEVPPTGYLLSFDTPGGQIQEILLPAGTTSHRLLRLFPSTFYS
AQLRAIWGESLTPPVLTSFTTGGLRIPFPRDCGEELKNGPSASKTTTIFLNGNRERPLDV
FCDMETDGGGWLVFQRRMDGQTDFWRDWEEYAHGFGNISGEFWLGNEALHSLTQAGDYSL
RVDLRAGKEAVFAQYDFFRVDSAKENYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNNL
LISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFQ
VPTRGT
NT seq 9381 nt   +upstreamnt  +downstreamnt
atggcagctcagtgcaccccgtctattctgaccatcctggtgttgcttggcttagccaga
gcaggcccattctctcctcggtctaatgtgacacttccggccccacggccccctcccaag
cccggtggtccttcttctcagctgtacgagcatactgtggaaggaggagagaagcaggtg
gtgttcacccatcgcattaacctgcccccgtcagccggctgcggctgtcccccgggctct
gagcccccggtgcctgcttcagaggtgcaggccctgagggtccgcctggagatcctggag
gagctggtaaaagggcttaaggagcactgcacaggaggatgctgtcccactgcggcccaa
gctggcacaggccagactgacgtgcgcagcctctgcagcctccacggtgtctttgacctg
agccgctgcgcctgttcctgtgagcctggctggggtggacccacctgctcagaccctacg
gacacaaagacgcccacctcatcgccgccctccaagtcctgtcccgaagactgcaacgac
cagggacgctgcgtccgaggacgctgcgtgtgcttccccggctacagtggccccagctgt
agctggccctcttgccctggagattgtcaggggcgcgggcgctgcgtgaagggcgtgtgc
gtgtgtcgcgcgggcttctcaggccctgactgcagccagcgctcttgccctcgcaactgc
aaccagagaggacgctgcgaggaaggacgctgcgtgtgtgaccccggctactccggtgag
gactgtggggtgcggagctgtcccaggggatgcagccaaagaggccgctgcgagaacggc
ctctgcgtgtgcaaccccggctactctggcgaggactgtggggtgcggaactgtcccagg
ggctgcagccagaggggtcgctgcgaggacggccgctgtgtgtgcgatcccggctatagt
ggcgaagattgcagcatgaggacctgcccatgggactgtggcgacggagggcgctgcgtg
gacggtcgctgcgtgtgctggcccgggtactcgggcgaagactgtagcacgcggacgtgc
ccgcgtgactgccgtggccggggccgctgcgaggacggggaatgtatctgtgacgcaggc
tacagtggcgacgactgcggtgtgcggagctgccccggggactgtaaccaaaggggccac
tgtgaggatggccgctgcgtgtgctggcccgggtatactggagcggactgtagcacgcgc
gcctgcccacgggactgcaggggccgcgggcgctgcgaggatggcgtgtgcgtgtgccat
gcgggctacagcggcgaggactgcggggtgcgcagctgccccggggactgtcgcggccgt
gggaactgcgagagcggccgctgcgtgtgctggcctgggtacacaggccgagactgtggc
acgcgtgcctgccccggtgactgtcgtggacgcgggcgctgcgtggacggccgctgcgtg
tgcaatccgggcttcactggcgaggactgcgggagccgtcggtgtcctggggactgtcgc
ggacacggccactgcgagaacggcgtgtgcgtgtgcgctgtgggctactctggcgacgac
tgcagcactcgcagctgtcccagcgactgcagaggccgcggccagtgcctgaatgggctc
tgcgagtgcgacgaaggctactcgggtgaggactgtggcataagacggtgtccccgcgat
tgcagccagcacggcgtgtgtcaggatggcttgtgcatgtgccacgcaggctatgcgggc
gaagactgcagcattcgcacctgcccggccgactgtcgccggcgtggccgctgtgaggac
gggcgctgtgtgtgcaacccaggctacaccgggcccgcatgtgccactcgaacctgtcca
gctgattgtcgtggccgtgggcgctgcgtgcagggagtgtgcatgtgctacgttggctac
agcggtgaggactgtggacaggaagagcctcctgctagtgcctgccctgggggctgtggg
ccgcgggaactgtgccgcgccggacaatgcgtgtgtgttgagggctttcgaggcccagac
tgtgccatccagacgtgcccaggtgactgtcgcagcaggggagagtgtatccagggcaga
tgcgtctgccaagaaggctacgctggggacgactgcggggaagagataccagccatccag
aacatgaggatgcatcttctagaggagacaacagtccggacagagtggacacgagctccc
ggtcctgtggatgcctatgaaatccagtttatccccatgaccgagggggtgagtccacca
ttcacagctcgggtgcccagctctgcctcagcctatgaccagcgaggactggcgcctgga
caggactaccaggtcactgttcgtgctctacgagggaccagctggggtcctcctgcctct
aagaccatcactaccatgatcgatggtcctcaggacctccgggtggtagctgtgaccccg
accacactggatcttagctggctgcgcccccaggctgaggtggaccgatttgtggtgtcc
tatgtcagtgctggaaaccaaagggtgcgactggaagttccccctgaggcagacaggact
cagctaaccgatctgatgcctggtgtggagtatgtggtgactgtcactgcagaaagaggc
catgcagtcagctacccagcttctatcagggcgaatacagacagggctcaggaacagcct
gggaagccatcagtccagccacgcctgggtgaactgacagtgacaggcctgacctctgat
tccctgctcctgcactggactgtcccagagggggagtttgactccttcctgatccagtac
aaggacaaagacgggccccaggcgatatccgtggagggaccccagcgttctacacccatc
tcaggcttggaaccaggacgcaagtacaaatttatcctgtatggactcatcggcaagaag
aggcatggcccacttatggctgaagccaagatcttgattcagagtgaccctgacccagga
tccccaccccgcctgggagagctatgggtgacagaccccactccacactcattgcacctc
tcctggactgttctcggaggccagttcgactccttcgtggtccagtacagagacaaggaa
ggccagccccgtgtggtacctgtggaggggcctgatcgctcagtggtgatctccccactg
gaccccaatcgcaagtacaggttcactctgtttgggattgccaataagaagcggtacggg
ccccttactgctgatggcactactgctgcagagacgaaagaggagtcctcagagccgccc
cgcctcggcgaactgactgtgactggtgtgaccccagactccctgcgcctgtcctggaca
gtggcccggggtcccttcgactcctttgtaatcctttacaaggatgcacagggccagccc
cagagtgtacccatcgaaggtgatgagaatgaggtcactgtccccggcctggagtccaac
aggaagtataagatgaacctctacgggcttcgtggcaggcagcgtgtggggccggtatca
gtggtggccaaaactgccccaccagatgttgtagaccagcccctcagccccccagagccc
agcacagaggccccagagccccccgagaagccactcctgagagagctgatcgtgacagac
accacacccaactccctgagcctctcctggacagtctccgagggacagtttgaccagttc
gtgatccagtacaagaacggggatgggcagcccaaggtggtgcgggtgccaggacacgag
gaccaggtcaccatctccggcctggagccagaccacaagtataagatgaacctgtatggc
atccatagtggccagcgtgtgggccccgtgtctgttgttggtgtgacagctgcagaggaa
gaaccccccagccccacagagcccagcacagaggcgccagaacccactgaggagccgctc
ctgggagagctgacagtgacaggatcgtccccagactccctgagcctctcctggaccgtc
ccccagggagactttgactccttcactgtccagtacaagagcagtgatgggcggccccag
gtgatgcgtgtcgggggccaggagagggaggtcatcgtgagagacctggatcctgggcac
aaatacaagatgaacctgtatggactccatgaggggcatcgtgtgggccctgtgtccact
gtgggcacaaccgacaaacaaccagaagaaaagcccccccttgagccacgcctggaggag
ttgacagtgactggtgtaacccccaattctgtgagcctctcgtggatagttcctgaggga
cagtttgactccttcgtggtccagtaccaggacagggatgggcagccccgggaggtacca
ctgacagcagaacagcgtgaggtcactgtccttgacttggaccctgcaagaatatacaaa
atgaacttctacgggctacacggtagacgacgtgtgggccccctctccgtgtcagcaatg
acagcaccagctccagccaccgaggcctccaagctgctcccagaaccacgactgggggaa
ctaacagtgacagatgtgaccccggactcagtgggcctcctgtggactgtccctgagggt
gaattcgactccttcacggtccagtacaaggacagggatggccagccccacgtggtgtct
gtggcagcagacctacgggaggtcaccatcccaggcctggagccctctcgcaagtacaag
ttcctgctctttggggtccaagatgggaaaagacgcagccaggtctctgtagaggcgaag
acagctacccatgatgacaccagcccaggggcccctccccgccttggagagctgtgggtg
acggatcctaccacggactctctgcgcctatcctggacagttcccgagggccactttgac
tcttttgtggtccagttcaaggacaaaagtgggcccagggtggtgccagtaaagggtcaa
gagcggacagccactatcacggccctggatgctggccgcaagtacagattcctcctctat
gggcttctgggaaggaaacgctttggccccctcactgcagagggcataacagagcccacg
aatgctgcggaccacacaaaatctcgactgggagaggaactgcgggtgactggtgtgact
caaaactccgtggacctctcctggacagtctccgagggccagtttgactcctttgtggtc
cagtacaaggacagggatgggcagtcccaggtggtgcctgtggacggaagccatagagag
gttagagtctctggtctagacccaggtcgcaggtataagctgctactctacggcctccga
gacagcaagcgtgtgggtcccctttcagtcattgctgtgaccgaccccagagaaacaaca
gaagcttggacagaggtccccacaacttcaactcctgcagctgtgccccgcctcggggag
ctgagagtggaggaagccacgcctcacagcctgcatctctcctgggtggtgactgaggga
gaatttaactccttcgaggtccagtacactgacagagatgggcaactcagagtggccagt
acagagggtgaccagactgacattacccttactggcctggaatcgaaccacagatacctg
ataaccctatatggcttccatgatgggcagcctgtaggctctgctcaaattgaggccctg
acagtgccgtgggaggaagaagaggaggaagaggagtccacagagccacccaccatgact
cctgagcccaggccacaactgggagagctgaccgtgacagatgccacccctgactctctg
agcctttcctggacagtccccgagggacagtttgaccagttcgtgatccagtacaagaac
ggggatgggcagcccaaggtggtgcgggtgccagggcatgaggaccaggtcaccatctct
ggcctggagccagaccacaagtacaagttgaacctgtatggcatccacagtggtcagcgt
tttggccccgtgtctactgttggggtgacagctgcagtggaagagccccccagccccaca
gagcccagcatagaggccccagagcccactgaggagccactcctgggagagctgacagtg
acaggatcgtccccagactctctgagcctctcctggaccgttccccagggagactttgat
tccttcactgtccagtacaaggacagtgatgggcggccccaggtgatgcgtgtcgggggc
caggagagggaggtcatcgtgagagacctggatcctgggcgcaagtacaagatgaacctg
tatgggctccatgaggggcgtcgtgtgggtcccgtgtcgactgtgggtgtgactgcctct
ctgaccacagagccccccatagagccccgcctgggagagctggctgcagtagaagtgact
tccagtacagtgcacctgtcctggactgtggcccagggccccttcgactccttcctggtc
cagtacaaggacacacaggggcagccccagatggtgcctgtgagtggagacctgggtgag
gtcaccgtctcaggtttggagccagcccgaaagtacaagtttctactctttggactcaag
gatgggaagcgccatggccctgtctccacagaagcaaagactgtctctgatgcaaagctg
cttcctcgtcttggggagctcaccgtgacagacacgacccaaaactccgtgggtctctcc
tggactgttcctgagggtgaattcgactctttcttagtccagtacaagaacaggggaggg
caggtccaggtcgtgcctgcagcagcagaccaacgtgaggtcaccatctccagcctggag
cccaatagaaaatacaggttcctgctcttcggcctcataggcctcaaacggctggggcct
gtctccgtggagggcaccacggctcccgtggagaagacaccacagccccgcctcggtgaa
ctgtcagtgacagaggagacctctgactccatgcacctctcttggtctgtggcccagggt
ccctttgactccttcctggtccagtacaaggacagggatgggcagctccagacggtgtcc
ttggctgcagaccagcgagaggtcaccatagagggtctacagccaggcaggaaatacaag
ttcctgctctatgggctcactggagggaagcgcctgggacccatctctgccttgggagtg
acagcctcagaagttgacatatcagccccagaccacactgagccccctcatgctcccggc
ctggggacgctggcagtgacagaggcaaccccagactccctgcgactctcctgggctgtg
gctcgtggcccctttgactcctttgtggtccagtaccaggacacagagaatgaaacccag
gccctgcttgttgatggagaccaggacaaagtcctcatctcaggcctggaacccaaaact
tcctacaagttcttcctctatggcctccgtgaagggacacgccacggacctgtgtctgta
gagggcaccacagatccagttcctgctggtcagggcccaggggaccccgggccccgcctg
tcccagctctcagtttcagatgtgaccaccagttctctgcggctaaactgggaagccccg
cttggggcctttgactctttcctgctacgctttggggtccccctactgagtaccctggag
cagaatcctcgcactctgcaacagcgagagcttatggtgccaggcgtgcggcgatccgcc
atgctccgggacctgcgtcctgggaccctgtatagccttactctgtatgggctgcgtggg
ccacacaaggcagacagcatccagggcactgcccgcacactcagcccagttctggagagc
ccccgggacctgcaattcagcgacatcggggaaacatcagccaaagtcaaatgggtgccg
ccaacgtccagggtggacagcttcaaaatctcctaccagctagcagatggaggagagcca
caaagtgtgcaggtggatggccggacccagacccagatcctccaagggctgattccagac
actcgctatgaggtgactgtggtctccgtccgtggctttgaggaaagcgagcctctcaca
ggcttcctcaccacagtgcctgatggtcccacccagctacgggcattgaacttgactgac
ggatctgcccttctacactggaaacccccccacaaaccagtggacaaatatgacgtcgag
gtcgaatcccctggggccccaccccttcaggcctcagcacctggcagcgctgtggactac
ccactgactgacctggcactcgacaccaattacacagccaccgtgcgtggtctccggggt
cctaacttcacctccccagccagcataaccttcaccacagggttaaagcccccccaggac
ttggaggccaaggaagtgactcctcgcacggccctgctcacttggactgagcctgaagtc
ccacccacaggctacctgctcagctttgacacccctggaggacagattcaggaaatcctg
cttccagcaggaaccacctcgcacaggcttctgcgcctcttcccctccaccttctacagt
gcccagctgcgggccatctggggcgagagccttacacctcccgtgctcacttcctttact
actggtgggctgcggatccccttcccccgggactgtggggaggagctgaagaatgggccc
agtgcctcaaagaccaccaccatcttcctcaatggcaaccgtgagcggcctttggatgtg
ttctgtgacatggagactgatggaggtggttggctggtgttccagcgccgcatggatgga
cagacggacttctggagagactgggaggagtacgcccatggttttgggaacatttccggg
gaattctggctgggcaacgaggccctgcacagcctaacacaggctggagactattctctg
cgtgtggacctgcgggccggaaaggaagccgtgttcgcccagtatgacttcttccgtgta
gactcagcaaaggagaactaccgcctacaccttgagggctaccatgggactgcaggcgac
tctatgagctaccacagtggcagtgtcttttctgcccgtgatcgagaccccaacaacttg
ctcatctcttgcgctgtctcttatcgtggggcttggtggtacaggaactgtcactacgcc
aacctcaatgggctctatgggagcacagtggatcaccagggagtgagctggtaccactgg
aagggcttcgagttctctgtgcccttcacggaaatgaagctgcgacccagaaacttccag
gtccccaccaggggcacctga

DBGET integrated database retrieval system