KEGG   Mus musculus (house mouse): 219249
Entry
219249            CDS       T01002                                 
Symbol
Tdrd3, 4732418C03Rik, 6720468N18
Name
(RefSeq) tudor domain containing 3
  KO
K18404  tudor domain-containing protein 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    219249 (Tdrd3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    219249 (Tdrd3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     219249 (Tdrd3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    219249 (Tdrd3)
SSDB
Motif
Pfam: RMI1_N_C TUDOR UBA SMN_Tudor SGF29_Tudor HBS1_N
Other DBs
NCBI-GeneID: 219249
NCBI-ProteinID: NP_766193
MGI: 2444023
Ensembl: ENSMUSG00000022019
UniProt: Q91W18
Structure
Position
14:87647598..87782944
AA seq 743 aa
MAEVSGAALSQAGWYLSDEGVEACTSSPGKGSINDIILIALNTDLRTIGKKFLPSDINGG
KVEKLEGPCVLQIQKVRNVAAPKDNEESQAAPRMLRVQMTDGHTSCTAVEFSYISKISLN
TPPGTKVKLSGTVDIKNGFLLLSDSNTTVLGGEVEHLIDKWALQRSLLKHNRSNIGAEGG
PPPFLPFGQKCASNVQVDSRELDRRKTLQVSLPAKPANDNDEFEKQRTAAIAEVAKSKET
KTFGGGGGGARSNLNIGAAGHRNREVLQKEKASKSESKNEGVYRELVDEKALKHITEMGF
SKEASRQALMDNANNLEAALNVLLNSSKQKPAVGPPARGRGKGRGRGRSEDEEDLGTARP
SAPSTLFDFLESKMGTLNVEEPKSQPQHLHQGQHRGWNAEQNGMKDGTQSRHLPRNDTRQ
PRNERPPRFQKDTPTSKSTVENSVLSRNRGSERPSSSSGSDVWAEERIKCDRPYSRYDRT
KDASHPLGLQHNDGAFKKRENSMQNRPGRGPLYAEAKENPLPPEFVDYNNQRRGRRENQT
GHPDHCYERKPRTMNSEAVSGLKIEKHFSVNTDYPRPVQSNSLGVPNGETAPPLKGRRVG
PIKSAGPVTAVPYDDKIFYNSGPKRRSGPIKPEKVIESSIPVEYAKVWKPGDECFALYWE
DNKFYRAEVEALHSSGMTAVVKFTDYGNYEEVLLSNIKPVQTEAWEEEGTYDHTIEFRRG
GDGQPRRSTRPTQQFYQPPRARN
NT seq 2232 nt   +upstreamnt  +downstreamnt
atggccgaggtgtccggcgccgcgttgtcccaggcgggttggtacctttcagatgaaggc
gttgaagcctgcacaagctctcctgggaaaggcagcataaatgacatcatcctgattgct
ctcaatacagatttgagaacaattggcaagaagttccttcccagtgacatcaacggtgga
aaggtagagaagcttgaaggtccatgtgtcttacaaattcagaaggtccgcaatgttgct
gcgccaaaggataacgaggaatcgcaagctgcgccaaggatgctccgcgtgcagatgacg
gatgggcatacaagttgtacggcagtagaattcagttatatttcaaaaataagcctgaac
acaccacctggcacaaaagtgaagctctctggcactgtggacataaagaacggattcctg
ctcttaagtgactctaacaccacagttcttggtggtgaagtggaacacctaattgacaag
tgggctttacagagaagcttattaaagcataacagaagcaatattggagctgaaggtggc
ccacctccttttctaccttttgggcagaagtgtgcatctaacgtccaagtggatagcaga
gagcttgatcgaagaaagacattacaagtttccctgcctgccaagcctgcaaatgataat
gatgaatttgaaaagcaaagaactgctgccattgcagaggttgcaaagagcaaagagacc
aagacatttggaggaggtggaggtggtgccagaagtaatctcaatattggtgctgctggt
caccgaaatagggaggttttacagaaggaaaaggcttccaagtcagagagcaagaacgaa
ggtgtctatagagaattggttgatgagaaagccctgaaacacataacagaaatgggcttc
agtaaggaggcctcaaggcaagcgctgatggataatgccaacaacttagaagcagcactg
aatgtccttctgaacagcagtaaacagaagcctgctgtgggccctcctgctagaggaaga
gggaaaggcaggggtcgaggacgatcagaagatgaggaagacctgggaaccgcaagaccg
tcagcaccaagcacgttatttgatttcttggagtctaaaatgggaactctgaatgtggaa
gaacctaagtcacagccacagcaccttcatcaaggacagcacagaggatggaatgccgag
caaaatgggatgaaggacggcactcagtcaagacatcttcctcgaaacgataccaggcag
ccaagaaatgagaggccacctcgctttcaaaaagacaccccaacttccaagtcaactgta
gaaaacagcgtattatctagaaatagaggctccgaaaggccgagtagttcctcaggttct
gatgtatgggcagaagagaggatcaagtgtgacaggccatattctaggtatgacagaact
aaagacgcttcacatcctctaggccttcagcacaacgatggtgcttttaaaaagagagag
aactctatgcaaaacagaccaggaagaggccctttgtatgcagaggccaaagaaaaccca
cttcctccagaattcgtagattacaataatcaaagacgtgggagaagagaaaaccaaaca
ggtcatcctgatcactgttatgagaggaaaccacggacaatgaatagtgaagctgttagt
ggtctaaaaattgagaaacattttagtgtaaacactgattacccgaggcctgtgcagagc
aatagtcttggtgttccaaatggagagacagctccgcctctgaaaggaaggcgcgtagga
ccgattaagtcagcaggacctgtcacagctgtgccctacgatgataaaatattttataat
agtgggcccaaaagaaggtctgggccaattaagcctgaaaaggtgatagaatcatctatt
cctgtggagtatgcaaaagtgtggaaacctggcgatgaatgttttgcactttattgggaa
gacaacaagttttaccgagcagaagttgaagccttgcattcttcgggtatgacagcggtc
gttaagttcacggactacggcaactatgaagaggtgctactgagcaatatcaagcctgtt
cagacagaggcatgggaagaagaaggcacctatgatcacaccattgagttccgcagagga
ggtgatggacagccacgaaggtctactcggccaacgcagcagttttaccaacctcctcga
gctcggaactaa

DBGET integrated database retrieval system