KEGG   Mus musculus (mouse): 219257
Entry
219257            CDS       T01002                                 

Symbol
Pcdh20, C630015B17Rik, Pcdh13
Name
(RefSeq) protocadherin 20
  KO
K16498  protocadherin delta 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    219257 (Pcdh20)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    219257 (Pcdh20)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     219257 (Pcdh20)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Protocadherins
   219257 (Pcdh20)
SSDB
Motif
Pfam: Cadherin Cadherin_2
Other DBs
NCBI-GeneID: 219257
NCBI-ProteinID: NP_848800
MGI: 2443376
Ensembl: ENSMUSG00000050505
Vega: OTTMUSG00000050938
UniProt: Q8BIZ0 Q68FM5
Position
14:complement(88702183..88708832)
AA seq 952 aa
MRGRGNARSLLVQAVSLRPATWHPCLDMGHLHRPSSRTSHRNLPHVFLLFLFVGPFNCLA
SYSRATELLYSLNEGLPAGVLIGSLAEDLRLLPRASGRQNQQLLHPERTASEGNPPLSFS
LASGGLSGQYVTLNNRSGELHTSAQEIDREALCLDGGGGAAWAGSTSIASSPSSDSCLLL
LDVLVLPQEYFRFVKVKIAIRDINDNAPQFPISEISVWVPENSPVNTRLAIEHPAVDPDV
GINGVQTYRLLDYHGMFTLDVEENENGERTPYLIVMGALDRETQDQYVSIIIAEDGGSPP
LLGSATLTIGISDINDNCPLFIDSQINVTVYGNATVGTPVATVQAVDRDLGTNAQITYSY
SQKVPQETKDLFHLDEVTGVIKLSSKIGGSVLQTHKLTILANGPGCIPAVITALVSIIKV
VFRPPEIVPRYIANEVDGVVYLKELEPVNTPIAFFTIRDPEGKYKINCFLDGEGPFRLAP
YKPYNNEYLLETTKPMDYEVQSFYEIAVVAWNSEGFHVKRIIKVQLLDDNDNAPVFLQPL
IELTIEENNAPNAFLTKLYATDADSGEMGRVSYFLGPDAPSYFSLDSVTGILTVSTQLDR
EEKEKYRYTVRAVDCGTPPRESVATVALTVLDKNDNSPRFINKDFSFFVPENFPGYGEIG
VISVTDADAGRNGWVALSVMNQSDIFVIDTGKGMLRAKVSLDREQQSSYTLWVEAVDGGE
PALSSTTKITILLLDINDNPPLVLFPQSNMSYLLVLPSTLPGSPVTEVYAVDKDTGMNAV
IAYSIIGRRGPRPESFRIDPKTGNITLEEALLQTDYGLHRLLVKVSDHGYPEPLHSTVMV
NLFVNDTVSNESYIESLLRKEPEINIEEKEPQISIEPTHRKVESMSCMPTLVALSVISLG
SITLVTGMGIYICLRKGKKHHREDDNLEVQIPLKGKIDLCMRERKPVDISNI
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgcgcggccgagggaacgcgcgcagcttgctggtccaggcagtgagcttgcgcccggcg
acctggcacccgtgcctggatatggggcatctacatcgtcccagcagcaggaccagccac
aggaacctgccgcatgtttttctgcttttcctcttcgtgggacccttcaattgcctcgcg
agttacagccgtgctaccgagcttctgtacagcctaaatgagggactgcccgccggagtg
ctcataggcagcctggcggaggacctgaggctgctgcctcgggcctctgggagacagaac
cagcagttgctgcatccagagcgcactgcctctgaggggaacccccctctctctttcagc
ttggcctccgggggactgagtggccagtatgtgaccctaaacaaccgctccggcgagctg
cacacttctgcacaggagatcgacagagaagcattgtgcctggatgggggcggtggggct
gcctgggccggcagtacctccattgcctcctctccttcttctgactcttgccttttgctt
ctggacgtgctggtcctgcctcaggaatattttcggtttgtgaaggtgaaaattgccatc
agggatatcaatgacaatgctccgcagttccccatttctgaaatctctgtttgggtccca
gaaaattcacctgtaaatacccgattggctatagagcatcctgctgtggaccctgatgta
ggcattaacggtgtgcaaacctatcgcttactagactaccatggcatgtttaccctggac
gtggaggagaatgagaacggggagcgcacaccctacttgattgtcatgggtgctttggac
agagaaacccaggaccagtatgtgagcatcatcatagctgaggatggtgggtctccacca
ctgctgggcagtgccaccctcaccattggcataagtgacattaatgacaattgtcctctc
tttatagactcacaaattaatgtcaccgtttatgggaatgctacagtgggcaccccagtt
gcaacagtccaggctgtggatagagacttggggacaaatgcacagatcacttacagttac
agccagaaagttccacaggaaaccaaggatttattccacctggatgaagttactggagtc
attaagctttccagtaagattggcgggagtgtcctacagacacataagctcaccatccta
gctaatggacctggctgtatccctgcagtgatcactgctcttgtatcgatcatcaaagtc
gttttcagacccccagaaatcgtcccacgttatatcgcaaatgaggtggatggtgttgtg
tacctgaaagaactggagcctgttaatactccaattgcgttttttaccatcagagatcca
gaaggtaaatacaagattaactgcttcttggatggtgaagggccattcaggctggcaccc
tacaagccgtacaacaatgaatatttgttggagaccacaaagcctatggactatgaagtg
cagtccttctatgaaatagctgtagtggcctggaactcagagggatttcatgtcaagaga
atcattaaagtacaacttttagacgacaatgacaatgcccctgttttccttcagcccttg
atagaattgaccattgaagaaaacaacgcacccaatgcctttctgacaaagctctacgct
acagatgctgacagtggagagatgggacgagtttcctacttcttgggacctgatgctccg
tcatacttttccttagacagtgtcacagggattctgacagtttctactcagctggacaga
gaagagaaagagaagtacaggtatactgtccgagcagtggactgtgggacgccacccaga
gaatcagtggctacagtggccctcactgtgttggataaaaatgacaacagtccgaggttc
atcaacaaggacttcagcttttttgtcccagaaaactttccggggtatggtgaaattgga
gtcatcagtgtaacagatgccgatgctggaaggaacggatgggtagccctgtccgtaatg
aaccagagtgacatttttgtcatagacacaggcaagggtatgttgagagctaaagtctct
ttagacagagaacagcaaagctcttacactctgtgggtggaggctgttgacgggggtgag
cctgccctttcctctaccacaaaaatcacaattcttcttctggacatcaacgataaccct
cctcttgttttattccctcaatctaatatgtcttatttgctggtcctaccttctactctc
cctggctcaccagtaacagaagtctatgcggttgacaaagacacaggcatgaatgctgtc
atagcttatagcatcatagggagaagaggtcccaggcctgagtctttcagaattgacccc
aagactggcaacatcactctggaggaagccttgcttcagacagattatgggttgcatcgc
ttactggtgaaagtgagtgatcacggataccctgagcctctccactccacagtcatggtg
aacttatttgtcaatgacactgtcagtaacgagagctacattgagagccttttgagaaag
gagccagaaattaatatagaagagaaagaaccacaaatctcaatagagccaactcatagg
aaggtagaatctatgtcctgtatgcccacattggtagctctgtcagtcataagcttgggc
tccatcacactagttacagggatgggaatatacatctgcttacggaaaggtaaaaagcat
cacagggaagatgacaatttggaagtacagattccattgaaaggaaaaattgacttgtgt
atgagagagagaaaaccagtggatatttctaacatttga

DBGET integrated database retrieval system