KEGG   Mus musculus (mouse): 21936Help
Entry
21936             CDS       T01002                                 

Gene name
Tnfrsf18, AITR, Gitr
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 18
  KO
K05154  tumor necrosis factor receptor superfamily member 18
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21936 (Tnfrsf18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    21936 (Tnfrsf18)
   04090 CD molecules [BR:mmu04090]
    21936 (Tnfrsf18)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   21936 (Tnfrsf18)
CD molecules [BR:mmu04090]
 Proteins
  21936 (Tnfrsf18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 21936
NCBI-ProteinID: NP_033426
MGI: 894675
Ensembl: ENSMUSG00000041954
Vega: OTTMUSG00000010984
UniProt: O35714 Q540M6
Position
4; 4 E2
AA seq 228 aa AA seqDB search
MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERC
ICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWT
NCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQL
RRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgggggcatgggccatgctgtatggagtctcgatgctctgtgtgctggacctaggtcag
ccgagtgtagttgaggagcctggctgtggccctggcaaggttcagaacggaagtggcaac
aacactcgctgctgcagcctgtatgctccaggcaaggaggactgtccaaaagaaaggtgc
atatgtgtcacacctgagtaccactgtggagaccctcagtgcaagatctgcaagcactac
ccctgccaaccaggccagagggtggagtctcaaggggatattgtgtttggcttccggtgt
gttgcctgtgccatgggcaccttctccgcaggtcgtgacggtcactgcagactttggacc
aactgttctcagtttggatttctcaccatgttccctgggaacaagacccacaatgctgtg
tgcatcccggagccactgcccactgagcaatacggccatttgactgtcatcttcctggtc
atggctgcatgcattttcttcctaaccacagtccagctcggcctgcacatatggcagctg
aggaggcaacacatgtgtcctcgagagacccagccattcgcggaggtgcagttgtcagct
gaggatgcttgcagcttccagttccctgaggaggaacgcggggagcagacagaagaaaag
tgtcatctggggggtcggtggccatga

DBGET integrated database retrieval system