KEGG   Mus musculus (mouse): 21937Help
Entry
21937             CDS       T01002                                 

Gene name
Tnfrsf1a, CD120a, FPF, TNF-R, TNF-R-I, TNF-R1, TNF-R55, TNF-alphaR1, TNFAR, TNFR60, TNFRI, TNFRp55, TNFalpha-R1, Tnfr-2, Tnfr1, p55, p55-R
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 1a
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04150  mTOR signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04668  TNF signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21937 (Tnfrsf1a)
   04064 NF-kappa B signaling pathway
    21937 (Tnfrsf1a)
   04668 TNF signaling pathway
    21937 (Tnfrsf1a)
   04071 Sphingolipid signaling pathway
    21937 (Tnfrsf1a)
   04150 mTOR signaling pathway
    21937 (Tnfrsf1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21937 (Tnfrsf1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    21937 (Tnfrsf1a)
   04215 Apoptosis - multiple species
    21937 (Tnfrsf1a)
   04217 Necroptosis
    21937 (Tnfrsf1a)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    21937 (Tnfrsf1a)
  09158 Development
   04380 Osteoclast differentiation
    21937 (Tnfrsf1a)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    21937 (Tnfrsf1a)
   05014 Amyotrophic lateral sclerosis (ALS)
    21937 (Tnfrsf1a)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    21937 (Tnfrsf1a)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    21937 (Tnfrsf1a)
   04931 Insulin resistance
    21937 (Tnfrsf1a)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    21937 (Tnfrsf1a)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    21937 (Tnfrsf1a)
   05170 Human immunodeficiency virus 1 infection
    21937 (Tnfrsf1a)
   05164 Influenza A
    21937 (Tnfrsf1a)
   05160 Hepatitis C
    21937 (Tnfrsf1a)
   05168 Herpes simplex infection
    21937 (Tnfrsf1a)
   05163 Human cytomegalovirus infection
    21937 (Tnfrsf1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    21937 (Tnfrsf1a)
   05165 Human papillomavirus infection
    21937 (Tnfrsf1a)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    21937 (Tnfrsf1a)
   05142 Chagas disease (American trypanosomiasis)
    21937 (Tnfrsf1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    21937 (Tnfrsf1a)
   04090 CD molecules [BR:mmu04090]
    21937 (Tnfrsf1a)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   21937 (Tnfrsf1a)
CD molecules [BR:mmu04090]
 Proteins
  21937 (Tnfrsf1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death DUF4880
Motif
Other DBs
NCBI-GeneID: 21937
NCBI-ProteinID: NP_035739
MGI: 1314884
Ensembl: ENSMUSG00000030341
Vega: OTTMUSG00000023806
UniProt: P25118 Q3U479
Position
6 F3; 6 59.32 cM
AA seq 454 aa AA seqDB search
MGLPTVPGLLLSLVLLALLMGIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCT
KCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQAD
KDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECV
PCSHCKKNEECMKLCLPPPLANVTNPQDSGTAVLLPLVILLGLCLLSFIFISLMCRYPRW
RPEVYSIICRDPVPVKEEKAGKPLTPAPSPAFSPTSGFNPTLGFSTPGFSSPVSSTPISP
IFGPSNWHFMPPVSEVVPTQGADPLLYESLCSVPAPTSVQKWEDSAHPQRPDNADLAILY
AVVDGVPPARWKEFMRFMGLSEHEIERLEMQNGRCLREAQYSMLEAWRRRTPRHEDTLEV
VGLVLSKMNLAGCLENILEALRNPAPSSTTRLPR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgggtctccccaccgtgcctggcctgctgctgtcactggtgctcctggctctgctgatg
gggatacatccatcaggggtcactggactagtcccttctcttggtgaccgggagaagagg
gatagcttgtgtccccaaggaaagtatgtccattctaagaacaattccatctgctgcacc
aagtgccacaaaggaacctacttggtgagtgactgtccgagcccagggcgggatacagtc
tgcagggagtgtgaaaagggcacctttacggcttcccagaattacctcaggcagtgtctc
agttgcaagacatgtcggaaagaaatgtcccaggtggagatctctccttgccaagctgac
aaggacacggtgtgtggctgtaaggagaaccagttccaacgctacctgagtgagacacac
ttccagtgcgtggactgcagcccctgcttcaacggcaccgtgacaatcccctgtaaggag
actcagaacaccgtgtgtaactgccatgcagggttctttctgagagaaagtgagtgcgtc
ccttgcagccactgcaagaaaaatgaggagtgtatgaagttgtgcctacctcctccgctt
gcaaatgtcacaaacccccaggactcaggtactgcggtgctgttgcccctggttatcttg
ctaggtctttgccttctatcctttatcttcatcagtttaatgtgccgatatccccggtgg
aggcccgaagtctactccatcatttgtagggatcccgtgcctgtcaaagaggagaaggct
ggaaagcccctaactccagccccctccccagccttcagccccacctccggcttcaacccc
actctgggcttcagcaccccaggctttagttctcctgtctccagtacccccatcagcccc
atcttcggtcctagtaactggcacttcatgccacctgtcagtgaggtagtcccaacccag
ggagctgaccctctgctctacgaatcactctgctccgtgccagcccccacctctgttcag
aaatgggaagactccgcccacccgcaacgtcctgacaatgcagaccttgcgattctgtat
gctgtggtggatggcgtgcctccagcgcgctggaaggagttcatgcgtttcatggggctg
agcgagcacgagatcgagaggctggagatgcagaacgggcgctgcctgcgcgaggctcag
tacagcatgctggaagcctggcggcgccgcacgccgcgccacgaggacacgctggaagta
gtgggcctcgtgctttccaagatgaacctggctgggtgcctggagaatatcctcgaggct
ctgagaaatcccgccccctcgtccacgacccgcctcccgcgataa

DBGET integrated database retrieval system