KEGG   Mus musculus (mouse): 21941
Entry
21941             CDS       T01002                                 

Gene name
Tnfrsf8, Cd30, D1S166E, Ki, Ki-1
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21941 (Tnfrsf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    21941 (Tnfrsf8)
   04090 CD molecules [BR:mmu04090]
    21941 (Tnfrsf8)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   21941 (Tnfrsf8)
CD molecules [BR:mmu04090]
 Proteins
  21941 (Tnfrsf8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 21941
NCBI-ProteinID: NP_033427
MGI: 99908
Ensembl: ENSMUSG00000028602
Vega: OTTMUSG00000010015
UniProt: Q60846
Position
4 E1; 4 78.17 cM
AA seq 498 aa
MSALLTAAGLLFLGMLQAFPTDRPLKTTCAGDLSHYPGEAARNCCYQCPSGLSPTQPCPR
GPAHCRKQCAPDYYVNEDGKCTACVTCLPGLVEKAPCSGNSPRICECQPGMHCCTPAVNS
CARCKLHCSGEEVVKSPGTAKKDTICELPSSGSGPNCSNPGDRKTLTSHATPQAMPTLES
PANDSARSLLPMRVTNLVQEDATELVKVPESSSSKAREPSPDPGNAEKNMTLELPSPGTL
PDISTSENSKEPASTASTLSLVVDAWTSSRMQPTSPLSTGTPFLDPGPVLFWVAMVVLLV
GSGSFLLCYWKACRRRFQQKFHLDYLVQTFQPKMEQTDSCPTEKLTQPQRSGSVTDPSTG
HKLSPVSPPPAVETCASVGATYLENLPLLDDSPAGNPFSPREPPEPRVSTEHTNNRIEKI
YIMKADTVIVGSVKTEVPEGRAPAGSTESELEAELEVDHAPHYPEQETEPPLGSCTEVMF
SVEEGGKEDHGPTTVSEK
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgagcgccctactcaccgcagcggggttgctgttcctggggatgcttcaagccttccca
acggatcgaccactcaagaccacctgtgccggagacctcagccactacccaggggaggct
gccaggaactgctgttaccagtgcccctcagggttgtctccgacacagccatgcccacgg
ggtcctgcccactgcaggaagcagtgtgcacctgactactacgtcaatgaagacgggaag
tgcacagcctgcgtgacctgtttgccaggccttgtggagaaggctccgtgttccgggaac
tctcctcgaatctgtgagtgtcagcctggcatgcactgctgcacaccagcagtcaattcc
tgcgcccgctgcaaactccactgttctggagaggaggttgtcaagtctccaggcacagca
aagaaggacactatctgtgagctgccttcctcgggatctggtcccaattgctccaatccg
ggtgaccgcaagacacttactagccatgccactcctcaggccatgcctactctagaatcc
ccagccaatgacagtgcaaggagcttgctgccaatgcgtgtcaccaaccttgtgcaggaa
gatgctactgagttggtgaaggttccagaatcttcctcgtccaaggcaagggagcccagt
ccagatccaggtaatgcagagaagaatatgaccttggagcttccatctccagggacactc
cctgacatcagcacctcagaaaacagcaaggagcctgcaagtaccgcctccaccctaagc
cttgtggtagatgcctggaccagcagcaggatgcagcccacctctccattgtccacggga
acaccatttctggatccagggcccgtgctcttctgggtggccatggtggtgctactggtt
ggctccggctcctttctcctgtgttactggaaggcctgtaggaggcggttccagcagaag
tttcacctggactacctagtgcagaccttccagcccaagatggagcagacagattcctgt
cctactgaaaagctaacccagccacagagaagcgggtcggtgacagatcccagcacggga
cacaagttgagcccagtgagccctcctccagctgtagagacttgtgccagtgttggggcc
acctacctggagaacctgccgctgctggatgacagcccagctgggaatcctttttctccc
agggaacctccagagccccgggtatccacggaacacaccaataacaggattgagaaaatc
tacatcatgaaggccgacacagtgatcgtgggctctgtaaaaactgaagtccctgagggc
cgggctccagcagggtctacagagtctgagttggaagctgaactagaagtggaccatgcc
ccccattacccggagcaggagacagaaccacctctgggcagctgcactgaggtcatgttc
tcggtggaggaaggaggaaaagaggaccatgggcccacgactgtctctgagaagtga

DBGET integrated database retrieval system