KEGG   Mus musculus (mouse): 21943Help
Entry
21943             CDS       T01002                                 

Gene name
Tnfsf11, Ly109l, ODF, OPGL, RANKL, Trance
Definition
(RefSeq) tumor necrosis factor (ligand) superfamily, member 11
  KO
K05473  tumor necrosis factor ligand superfamily member 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04917  Prolactin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05224  Breast cancer
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    21943 (Tnfsf11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21943 (Tnfsf11)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    21943 (Tnfsf11)
   04928 Parathyroid hormone synthesis, secretion and action
    21943 (Tnfsf11)
  09158 Development
   04380 Osteoclast differentiation
    21943 (Tnfsf11)
 09160 Human Diseases
  09162 Cancers: Specific types
   05224 Breast cancer
    21943 (Tnfsf11)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    21943 (Tnfsf11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    21943 (Tnfsf11)
   04090 CD molecules [BR:mmu04090]
    21943 (Tnfsf11)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   21943 (Tnfsf11)
CD molecules [BR:mmu04090]
 Proteins
  21943 (Tnfsf11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 21943
NCBI-ProteinID: NP_035743
MGI: 1100089
Ensembl: ENSMUSG00000022015
UniProt: O35235
Structure
PDB: 

Position
14 D3; 14 41.26 cM
AA seq 316 aa AA seqDB search
MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQ
VVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQ
AFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHK
VTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVY
VVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDP
DQDATYFGAFKVQDID
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgggccagccgagactacggcaagtacctgcgcagctcggaggagatgggcagc
ggccccggcgtcccacacgagggtccgctgcaccccgcgccttctgcaccggctccggcg
ccgccacccgccgcctcccgctccatgttcctggccctcctggggctgggactgggccag
gtggtctgcagcatcgctctgttcctgtactttcgagcgcagatggatcctaacagaata
tcagaagacagcactcactgcttttatagaatcctgagactccatgaaaacgcagatttg
caggactcgactctggagagtgaagacacactacctgactcctgcaggaggatgaaacaa
gcctttcagggggccgtgcagaaggaactgcaacacattgtggggccacagcgcttctca
ggagctccagctatgatggaaggctcatggttggatgtggcccagcgaggcaagcctgag
gcccagccatttgcacacctcaccatcaatgctgccagcatcccatcgggttcccataaa
gtcactctgtcctcttggtaccacgatcgaggctgggccaagatctctaacatgacgtta
agcaacggaaaactaagggttaaccaagatggcttctattacctgtacgccaacatttgc
tttcggcatcatgaaacatcgggaagcgtacctacagactatcttcagctgatggtgtat
gtcgttaaaaccagcatcaaaatcccaagttctcataacctgatgaaaggagggagcacg
aaaaactggtcgggcaattctgaattccacttttattccataaatgttgggggatttttc
aagctccgagctggtgaagaaattagcattcaggtgtccaacccttccctgctggatccg
gatcaagatgcgacgtactttggggctttcaaagttcaggacatagactga

DBGET integrated database retrieval system