KEGG   Mus musculus (mouse): 21945Help
Entry
21945             CDS       T01002                                 

Gene name
Dedd, CASP8IP1, DEFT, Dedpro1, FLDED1, KE05
Definition
(RefSeq) death effector domain-containing
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DED
Motif
Other DBs
NCBI-GeneID: 21945
NCBI-ProteinID: NP_001122081
MGI: 1333874
Ensembl: ENSMUSG00000013973
Vega: OTTMUSG00000021703
UniProt: Q9Z1L3 Q3U001
Position
1 H3; 1 79.34 cM
AA seq 318 aa AA seqDB search
MAGLKRRASQVWPEERGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGL
IRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKKRRAVCPDLVDKYLEE
TSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGSQMCSKRPARGRTTLGSQRKRR
KSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKSRD
LGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEED
YELGRQKLLRNLMLQALP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcctaaagaggcgggcaagccaggtgtggcccgaagagcgtggggagcaagaa
catgggctctacagcctccaccgcatgttcgacatcgtgggcacccacctaacacacaga
gatgtccgagtgctttccttcctttttgttgatgttattgatgaccatgaacgtggactc
atccgaaatggacgtgacttcttattggcactggagcgccagggccgctgtgacgagagt
aactttcgccaggtgctgcagctgctgcgcatcatcactcgccatgacttgctgccctac
gttactctcaagaagagacgagctgtgtgccctgatcttgtagacaagtatctggaggaa
acatcaattcgctatgtgacccccagagccctcagtgacccagaaccgaggcctccccag
ccctctaaaacagtgcctccccactatcctgtggtgtgctgccccacttcgggttctcaa
atgtgtagtaagcggccagcccgagggagaaccacacttgggagccagcgaaaacgccgg
aagtcggtgacaccagacccgaaggaaaagcagacatgtgatatcaggctccgagttcgg
gcggaatactgccagcatgagacggctctgcaaggcaatgtcttctccaataagcaggac
ccacttgagcgccagtttgagcgctttaaccaggccaacactatcctcaagtcccgggac
ctgggctccatcatctgtgacatcaagttctctgagctcacctacctcgacgcattctgg
cgagactacattaatggctcattattagaggcactgaaaggtgtcttcatcacagactct
ctcaagcaagctgtgggccatgaagccatcaagctgctggtgaacgtggatgaggaggac
tatgagctgggccgacagaaactcctgaggaacttgatgctgcaggcattaccctga

DBGET integrated database retrieval system