KEGG   Mus musculus (mouse): 21949Help
Entry
21949             CDS       T01002                                 

Gene name
Tnfsf8, CD153, CD30LG, Cd30l, Tnlg3a
Definition
(RefSeq) tumor necrosis factor (ligand) superfamily, member 8
  KO
K05471  tumor necrosis factor ligand superfamily member 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21949 (Tnfsf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    21949 (Tnfsf8)
   04090 CD molecules [BR:mmu04090]
    21949 (Tnfsf8)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   21949 (Tnfsf8)
CD molecules [BR:mmu04090]
 Proteins
  21949 (Tnfsf8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF C1q Staphylokinase DUF1831 RNA_pol_Rbc25
Motif
Other DBs
NCBI-GeneID: 21949
NCBI-ProteinID: NP_033429
MGI: 88328
Ensembl: ENSMUSG00000028362
Vega: OTTMUSG00000000301
UniProt: P32972 Q544U1
Position
4 C1; 4 34.06 cM
AA seq 239 aa AA seqDB search
MEPGLQQAGSCGAPSPDPAMQVQPGSVASPWRSTRPWRSTSRSYFYLSTTALVCLVVAVA
IILVLVVQKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSW
NEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVT
VCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggagccagggctgcaacaagcaggcagctgtggggctccttcccctgacccagccatg
caggtgcagcccggctcggtagccagcccctggagaagcacgaggccctggagaagcaca
agtcgcagctacttctacctcagcaccaccgcactggtgtgccttgttgtggcagtggcg
atcattctggtactggtagtccagaaaaaggactccactccaaatacaactgagaaggcc
ccccttaaaggaggaaattgctcagaggatctcttctgtaccctgaaaagtactccatcc
aagaagtcatgggcctacctccaagtgtcaaagcatctcaacaataccaaactgtcatgg
aacgaagatggcaccatccacggactcatataccaggacgggaacctgatagtccaattc
cctggcttgtacttcatcgtttgccaactgcagttcctcgtgcagtgctcaaatcattct
gtggacctgacattgcagctcctcatcaattccaagatcaaaaagcagacgttggtaaca
gtgtgtgagtctggagttcagagtaagaacatctaccagaatctctctcagtttttgctg
cattacttacaggtcaactctaccatatcagtcagggtggataatttccagtatgtggat
acaaacactttccctcttgataatgtgctatccgtcttcttatatagtagctcagactga

DBGET integrated database retrieval system