KEGG   Mus musculus (mouse): 21950
Entry
21950             CDS       T01002                                 

Gene name
Tnfsf9, 4-1BB, 4-1BB-, 4-1BB-L, 4-1BBL, AI848817, Cd137, Cd137l, Ly6, Ly63l
Definition
(RefSeq) tumor necrosis factor (ligand) superfamily, member 9
  KO
K05472  tumor necrosis factor ligand superfamily member 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21950 (Tnfsf9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    21950 (Tnfsf9)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   21950 (Tnfsf9)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 21950
NCBI-ProteinID: NP_033430
MGI: 1101058
Ensembl: ENSMUSG00000035678
UniProt: P41274 Q3U1Z9
Structure
PDB: 
6MKB 6MKZ

Position
17; 17 D
AA seq 309 aa
MDQHTLDVEDTADARHPAGTSCPSDAALLRDTGLLADAALLSDTVRPTNAALPTDAAYPA
VNVRDREAAWPPALNFCSRHPKLYGLVALVLLLLIAACVPIFTRTEPRPALTITTSPNLG
TRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQG
LRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALT
VELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLF
LVKPDNPWE
NT seq 930 nt   +upstreamnt  +downstreamnt
atggaccagcacacacttgatgtggaggataccgcggatgccagacatccagcaggtact
tcgtgcccctcggatgcggcgctcctcagagataccgggctcctcgcggacgctgcgctc
ctctcagatactgtgcgccccacaaatgccgcgctccccacggatgctgcctaccctgcg
gttaatgttcgggatcgcgaggccgcgtggccgcctgcactgaacttctgttcccgccac
ccaaagctctatggcctagtcgctttggttttgctgcttctgatcgccgcctgtgttcct
atcttcacccgcaccgagcctcggccagcgctcacaatcaccacctcgcccaacctgggt
acccgagagaataatgcagaccaggtcacccctgtttcccacattggctgccccaacact
acacaacagggctctcctgtgttcgccaagctactggctaaaaaccaagcatcgttgtgc
aatacaactctgaactggcacagccaagatggagctgggagctcatacctatctcaaggt
ctgaggtacgaagaagacaaaaaggagttggtggtagacagtcccgggctctactacgta
tttttggaactgaagctcagtccaacattcacaaacacaggccacaaggtgcagggctgg
gtctctcttgttttgcaagcaaagcctcaggtagatgactttgacaacttggccctgaca
gtggaactgttcccttgctccatggagaacaagttagtggaccgttcctggagtcaactg
ttgctcctgaaggctggccaccgcctcagtgtgggtctgagggcttatctgcatggagcc
caggatgcatacagagactgggagctgtcttatcccaacaccaccagctttggactcttt
cttgtgaaacccgacaacccatgggaatga

DBGET integrated database retrieval system