KEGG   Mus musculus (mouse): 21952Help
Entry
21952             CDS       T01002                                 

Gene name
Tnni1, 2700018B22Rik, AI747285, ssTnI
Definition
(RefSeq) troponin I, skeletal, slow 1
  KO
K10371  troponin I, slow skeletal muscle
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    21952 (Tnni1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     21952 (Tnni1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Troponin XkdW
Motif
Other DBs
NCBI-GeneID: 21952
NCBI-ProteinID: NP_001106173
MGI: 105073
Ensembl: ENSMUSG00000026418
Vega: OTTMUSG00000033121
UniProt: Q9WUZ5
Position
1 E4; 1 59.28 cM
AA seq 187 aa AA seqDB search
MPEVERKSKITASRKLMLKSLMLAKAKECWEQEHEEREAEKVRYLSERIPTLQTRGLSLS
ALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVLDLRGKFKRPPLRRVRVSA
DAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDA
AKSPTSQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagttgagaggaaatccaagatcactgcctcccgtaaactcatgctgaagagc
ctgatgctagccaaggccaaggagtgttgggagcaggaacacgaggagcgagaggctgag
aaggtgcgttacctctcggagcgcattcccacactgcagacccgcggtctgtctctcagt
gcccttcaggacttgtgccgagagctccatgccaaggtagaggtggtggatgaggagcgc
tatgatattgaagccaaatgcctccacaacaccagagagatcaaggacctgaagctgaag
gtgctggacctccgtgggaagttcaagcgtcctcccctgcgccgggtccgtgtctcagcc
gatgccatgctccgagccctactgggctctaagcacaaggtgtccatggatctgcgggcc
aacctcaagtctgtgaagaaagaagacacagaaaaggagcggccagtcgaggtaggagac
tggaggaagaatgtggaggctatgtctggcatggaaggccgcaagaagatgttcgacgct
gctaagtccccgacctcccagtag

DBGET integrated database retrieval system