KEGG   Mus musculus (mouse): 21954
Entry
21954             CDS       T01002                                 

Gene name
Tnni3, Tn1, cTnI
Definition
(RefSeq) troponin I, cardiac 3
  KO
K12044  troponin I, cardiac muscle
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    21954 (Tnni3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    21954 (Tnni3)
   04261 Adrenergic signaling in cardiomyocytes
    21954 (Tnni3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    21954 (Tnni3)
   05414 Dilated cardiomyopathy
    21954 (Tnni3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    21954 (Tnni3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     21954 (Tnni3)
SSDB
Motif
Pfam: Troponin Troponin-I_N Tup_N DUF919 Hamartin THP2 DUF3738
Other DBs
NCBI-GeneID: 21954
NCBI-ProteinID: NP_033432
MGI: 98783
Ensembl: ENSMUSG00000035458
Vega: OTTMUSG00000027089
UniProt: P48787 Q497F1
Position
7 A1; 7 2.61 cM
AA seq 211 aa
MADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQ
EMEREAEERRGEKGRVLRTRCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVT
KNITEIADLTQKIYDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKE
DIEKENREVGDWRKNIDALSGMEGRKKKFEG
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctgatgagagcagcgatgcggctggggaaccgcagcctgcgcctgctcctgtccga
cgccgctcctctgccaactaccgagcctatgccaccgagccacacgccaagaaaaagtct
aagatctccgcctccagaaaacttcagttgaagactctgatgctgcagattgcgaagcag
gagatggaacgagaggcagaagagcgacgtggagagaaggggcgcgttctgaggactcgt
tgccagcctttggagttggatgggctgggctttgaagagcttcaggacttatgccgacag
cttcacgctcgggtggacaaagtggatgaagagagatatgacgtggaagcaaaagtcacc
aagaacatcactgagattgcagatctgacccagaagatctatgacctccgtggcaagttt
aagcggcccaccctccgaagagtgaggatctctgcagatgccatgatgcaggcgctgctg
gggacccgggccaaggaatccttggacctgagggcccacctcaagcaggtgaagaaggag
gacattgagaaggaaaaccgggaggtgggagactggcgcaagaatatcgatgcactgagt
ggcatggaaggccgcaagaaaaagtttgagggctga

DBGET integrated database retrieval system