KEGG   Mus musculus (mouse): 21959
Entry
21959             CDS       T01002                                 

Gene name
Tnp2, TP, TP2, Tp-, Tp-2
Definition
(RefSeq) transition protein 2
  KO
K19925  nuclear transition protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21959 (Tnp2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    21959 (Tnp2)
SSDB
Motif
Pfam: TP2
Other DBs
NCBI-GeneID: 21959
NCBI-ProteinID: NP_038722
MGI: 98785
Ensembl: ENSMUSG00000043050
UniProt: P11378
Position
16 A1; 16 5.83 cM
AA seq 117 aa
MDTKMQSLPTTHPHPHSSSRPQSHTSNQCNQCTCSHHCRSCSQAGHAGSSSSPSPGPPMK
HPKPSVHSRHSPARPSHRGSCPKNRKTFEGKVSKRKAVRRRKRTHRAKRRSSGRRYK
NT seq 354 nt   +upstreamnt  +downstreamnt
atggacaccaagatgcagagccttcccaccactcatccccacccccacagctcctcgcgg
cctcaaagtcacaccagtaaccagtgcaatcagtgcacctgcagccaccactgccggagc
tgcagccaggcaggccacgcgggctctagctccagccccagccctggcccgcccatgaag
caccccaagccatccgtgcactctcgacactcacctgcaagacccagccaccgcgggagc
tgccccaagaacaggaagacctttgaagggaaagtgagcaagagaaaggccgtcaggagg
cggaaacggactcacagagctaagaggcgtagctcagggcgaagatacaagtga

DBGET integrated database retrieval system