KEGG   Mus musculus (mouse): 21968Help
Entry
21968             CDS       T01002                                 

Gene name
Tom1
Definition
(RefSeq) target of myb1 trafficking protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: VHS GAT Spectrin
Motif
Other DBs
NCBI-GeneID: 21968
NCBI-ProteinID: NP_035752
MGI: 1338026
Ensembl: ENSMUSG00000042870
Vega: OTTMUSG00000062024
UniProt: O88746 Q561M4
Position
8; 8 C1
AA seq 492 aa AA seqDB search
MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDAFRAVKKRIMG
NKNFHEVMLALTVLETCVKNCGHRFHVLVANQDFVENVLVRTILPKNNPPTIVHDKVLNL
IQSWADAFRSSPDLTGVVAVYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETPSRQNS
VSSNTSQRGDLSQHATPLPTPAVLPGDSPITPTPEQIGKLRSELEMVSGNVRVMSEMLTE
LVPTQVEPADLELLQELNRTCRAMQQRILELIPRISNEQLTEELLMINDNLNNVFLRHER
FERFRTGQTAKASSEAELATDLIDMGPDPAATNNLSSQLAGMNLGSRSVRAGLQSLETSG
HLEDDFDMFALTRGSSLADQRKGVKYEAPQTTDGLAGALDARQQSTGAIPATQARIMEDI
EQWLSTDVGNSAEEPSGVTSEEFDKFLEERAKAADRLPNLASPSAEGPPRPSPGTAPRRK
TQEKDDDMLFAL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggactttctcctgggaaatccgttcagctctccggtgggacaacggatcgagaaagct
acagatggctccctgcagagcgaggactgggccctcaacatggaaatctgtgacatcatc
aacgagacggaggaaggccccaaagatgccttccgagcagtgaagaagcgaattatgggg
aataagaatttccatgaggtcatgctggcccttacggtcttggaaacatgtgttaagaac
tgtgggcaccgcttccatgtactggtggccaaccaggactttgtagagaatgtgctggtg
aggaccatcctgccgaagaacaatccacccaccattgtgcatgacaaggtgttgaacctc
atccagtcctgggctgacgcgttccgcagctcacctgatttgacaggtgttgttgctgtc
tacgaggacctgcgaaggaagggcctagaatttcccatgactgacctggacatgctgtcg
cccatccacacaccccagagaactgtattcaactcagagacaccatccagacagaactct
gtgagttccaacaccagtcagcgtggagacctgagccagcatgccacccctctgcccact
ccagctgttctcccgggtgactcacccatcacaccgactcctgagcagattgggaagctg
cgcagtgagctggagatggtgagcggaaacgtgcgagtgatgtcagagatgctgacagag
ctggtgcccacccaggtagagcctgcagacctggagctactacaggaactgaaccgcacc
tgccgtgccatgcagcagcggatcctggagcttatcccacgcatctccaatgagcagctg
acggaggagctgctcatgatcaacgacaacctcaacaacgtgtttctgcgccatgaacgg
tttgaacgcttccgaacaggccagactgctaaggcctccagtgaagctgagctagctact
gacctgattgacatgggtcctgaccccgcagccacaaacaacctctcatctcaactggca
ggaatgaaccttggctccagaagtgtgagagctggcctgcagtctctggagacctcaggt
cacctggaagatgactttgacatgtttgctctgactcggggcagctcactggctgaccaa
cggaaaggggtcaaatatgaagctccccaaaccacagatggcctggctggggccctagat
gcccggcagcagagcaccggagcgatcccagccactcaggcccgcatcatggaggacatt
gagcagtggctgtccacagatgtggggaacagtgctgaggagccctctggtgtcaccagt
gaagaatttgacaaatttctggaagaacgagccaaagctgctgatcgacttcccaacctg
gccagcccttcagccgagggaccccccagaccatctcctggaacagcccctcggaggaag
acccaggagaaggacgatgacatgctgtttgccttatga

DBGET integrated database retrieval system