KEGG   Mus musculus (house mouse): 21985
Entry
21985             CDS       T01002                                 
Symbol
Tpd52, AI043038, mD52
Name
(RefSeq) tumor protein D52
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TPD52 AAA_13 Metal_resist Occludin_ELL TMF_DNA_bd Sec2p DUF3584 ERM_helical Cnn_1N PEP-utilisers_N GvpK GAS ATG14 Nsp1_C HsbA IBN_N MapZ_EC1 V_ATPase_I APG6_N SlyX
Other DBs
NCBI-GeneID: 21985
NCBI-ProteinID: NP_001020433
MGI: 107749
Ensembl: ENSMUSG00000027506
UniProt: Q62393
Position
3:complement(8991590..9069824)
AA seq 224 aa
MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNVGLLKTEPVAEEGEDA
VTMLSAPEALTEEEQEELRRELTKVEEEIQTLSQVLAAKEKHLAELKRKLGISSLQEFKQ
NIAKGWQDVTATNAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKV
ENLKSKVGGAKPAGGDFGEVLNSTANATSTMTTEPPPEQMTESP
NT seq 675 nt   +upstreamnt  +downstreamnt
atggagtgcagagatatggagttggctgatgattaccaatccccctttgattttgattct
ggagtgaacaagaactacctctacctctctccaagcgggaacacctcgccgcctggttca
cctacacagaacgttggtctgctgaagacagagccggtggccgaggaaggagaggatgct
gttaccatgctcagtgctccagaggcgctgacggaagaggagcaagaggagctgaggcgg
gagcttactaaggtggaagaagaaatccagactctgtcccaagtattggccgcaaaagag
aagcatctcgccgagctcaagcggaagctcggcatctcctcgcttcaggagttcaagcag
aacattgccaaagggtggcaagacgtgacggcaaccaatgcatacaagaagacctctgaa
actctatcgcaagctgggcagaaggcctccgctgcattttcatcggttggctcagtcatc
accaaaaagctggaagacgtgaaaaactccccaactttcaagtcatttgaagaaaaagtt
gaaaatttaaagtctaaagtaggaggagccaagcctgctggcggcgattttggagaagtc
ctgaattccacagccaacgctaccagtaccatgaccacagagcctcctccagaacagatg
acagagagcccctga

DBGET integrated database retrieval system