KEGG   Mus musculus (mouse): 22018
Entry
22018             CDS       T01002                                 

Gene name
Tpo
Definition
(RefSeq) thyroid peroxidase
  KO
K00431  thyroid peroxidase [EC:1.11.1.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00350  Tyrosine metabolism
mmu01100  Metabolic pathways
mmu04918  Thyroid hormone synthesis
mmu05320  Autoimmune thyroid disease
Module
mmu_M00043  Thyroid hormone biosynthesis, tyrosine => triiodothyronine/thyroxine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    22018 (Tpo)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    22018 (Tpo)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    22018 (Tpo)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.8  iodide peroxidase
     22018 (Tpo)
SSDB
Motif
Pfam: An_peroxidase EGF_CA EGF_3 Sushi Plasmod_Pvs28
Other DBs
NCBI-GeneID: 22018
NCBI-ProteinID: NP_033443
MGI: 98813
Ensembl: ENSMUSG00000020673
Vega: OTTMUSG00000025268
UniProt: P35419
Position
12 A2; 12 13.0 cM
AA seq 914 aa
MRTLGAMAIMLVVMGTVIFLSFILRSRDILCGKTMKSHVISAVETSQLMVDHAVYNTMKR
NLKKREVLSPAQLLSFFKLPESTSGAISRAAEIMETSIQVMKREQSQFSTDALSADILGT
IANLSGCLPFMLPPRCPDTCLANKYRPITGACNNRDHPRWGASNTALARWLPPVYEDGFS
QPKGWNPNFLYHGFPLPPVREVTRHLIQVSNEAVTEDDQYSDFLPVWGQYIDHDIALTPQ
STSTAAFWGGVDCQLTCENQNPCFPIQLPSNSSGTTACLPFYRSSAACGTGDQGALFGNL
SAANPRQQMNGLTSFLDASTVYGSSPGVEKQLRNWSSSAGLLRVNTLHLDAGRAYLPFAT
AACAPEPGTPRTNRTPCFLAGDGRASEVPALAAVHTLWLREHNRLASAFKAINKHWSANT
AYQEARKVVGALHQIITMRDYIPKILGPDAFRQYVGPYEGYNPTVNPTVSNIFSTAAFRF
GHATVHPLVRRLNTDFQEHTELPRLQLRDVFFRPWRLIQEGGLDPIVRGLLARAAKLQVQ
GQLMNEELTERLFVLSNVGTLDLASLNLQRGRDHGLPDYNEWREFCGLSRLETPAELNKA
IANRSMVNKIMDLYKHADNIDVWLGGLAEKFLPGARTGPLFACIIGKQMKALRDGDRFWW
ENTNVFTDAQRQELEKHSLPRVICDNTGLTRVPVDAFRIGKFPQDFESCEDIPSMDLELW
RETFPQDDKCVFPEEVDNGNFVHCEESGKLVLVYSCFHGYKLQGQEQVTCTQKGWDSEPP
VCKDVNECADLTHPPCHPSAQCKNTKGSFQCVCTDPYVLGEDEKTCIDSGRLPRASWVSI
ALGALLIGGLASLTWIVICRWTHADKKATLPITERVTTQSGCRKSQGRGISPHKAAAQDT
GQEPASGSRVLLCE
NT seq 2745 nt   +upstreamnt  +downstreamnt
atgagaacacttggagctatggcaataatgctggtggttatgggaactgtaattttcctc
tcttttatcctgagaagcagagacatcttgtgtgggaagaccatgaagtcccatgttatc
agtgctgtggaaacgagccagctcatggtggaccatgcagtctacaacaccatgaaaaga
aacctcaagaaaagggaagtcctttctccagcccagcttctctctttctttaagctgccc
gagtccaccagtggggctatttcccgagcagcagagattatggaaacatcaatacaagtc
atgaaacgtgaacagtcacagttctccacggatgccttatcagcagacattctgggcaca
attgccaacctgtcaggatgcttgcctttcatgctgccaccaagatgtcctgacacctgc
ctggcaaataagtaccggcccatcacaggggcgtgcaacaatagagatcaccccagatgg
ggagcctccaacacagccctagcaagatggctgcctcctgtctatgaagatggcttcagt
cagcccaaaggctggaaccctaatttcttataccacggcttcccactgcccccggtacgg
gaagtgacaaggcacctcattcaagtttccaatgaggctgtgaccgaagatgaccagtac
tctgattttctgccggtgtggggacagtacatcgatcatgacattgctctcacaccacag
agcactagcacagcagccttctggggaggtgtcgactgccagctgacctgtgagaaccaa
aatccttgcttccccatacagcttccctcaaactcctcagggaccactgcatgcctgcct
ttctaccgctcctccgccgcttgtggcactggggaccaaggtgctctctttggcaacctg
tctgcagccaatccgaggcagcagatgaatggcttgacctccttccttgatgcttccact
gtgtacggcagctcccctggcgttgagaagcagctgcgcaactggagcagctcggcagga
ctgctgcgtgtcaacactctccacctagatgctggccgtgcctacctgcccttcgcaaca
gccgcctgcgctccagagcctggtaccccacgcaccaaccgcacgccctgcttcctggct
ggagacggtcgcgccagtgaggtccctgccctggcagcggtacacaccttgtggctgcgc
gagcacaaccgcctggcttcggccttcaaggccattaacaagcactggagcgccaacact
gcctaccaggaggcgcgcaaggtggtaggggcactgcaccagatcatcaccatgagggat
tatatccccaaaatcctgggtcctgatgccttcaggcagtatgtgggcccctatgaaggc
tacaaccccactgtgaaccctactgtgtccaacatcttctccactgctgcctttcgcttt
ggccatgccacagtccatccactggtgagacggctaaacactgacttccaggagcacaca
gagctccccaggttgcagctgcgtgatgtcttcttcagaccctggaggcttatccaggaa
ggtggtttggatccgatagtgagaggcctcctggcgagagcagccaagctgcaagtccaa
gggcagctgatgaatgaggagctgaccgagaggctcttcgtgctgtctaacgtgggcacc
ttggatctggcatcactgaacttgcagaggggccgggatcatggcttaccagactacaat
gaatggagagagttctgtggcttgtcacgcctggagacaccagctgagctgaacaaggcc
attgccaacagaagcatggtcaacaagataatggacttatacaagcatgctgacaacatt
gacgtctggttgggaggcttggctgaaaagttcttgccgggggcccgcactggtcctctg
tttgcatgtatcattgggaagcagatgaaggctctgagggatggggacaggttttggtgg
gagaacaccaatgtcttcacagacgctcagaggcaggaactagaaaagcattcactacct
cgggtcatctgtgacaacactggactcaccagagtacctgtggatgccttccgtattgga
aagttcccccaagactttgaatcctgtgaggacatcccgagcatggaccttgaactatgg
agggagaccttcccacaagatgacaagtgtgtcttcccagaggaggtggacaatgggaac
tttgtgcactgtgaagagtctgggaagctggtgcttgtatactcctgtttccatggatac
aagctgcagggccaggagcaggtcacatgtacccagaagggatgggactccgaacctcct
gtctgtaaagatgttaatgagtgtgcagatctgacacacccaccttgccacccctctgca
cagtgcaagaacaccaagggaagcttccagtgtgtgtgcacagacccctatgtgctaggt
gaggatgagaagacctgcatagattctggcaggctacctcgggcatcctgggtctccatt
gcactgggtgcacttctcattggtggtttggccagtctcacctggatagtaatttgcagg
tggacacatgctgataagaaagccacattgccgatcacagagagagtgaccacccagtca
ggatgcagaaagagtcaggggagggggatttcaccacacaaggccgcagctcaagacact
ggacaggaacctgcaagtggatccagggtcctcctgtgcgaatag

DBGET integrated database retrieval system