KEGG   Mus musculus (house mouse): 22021
Entry
22021             CDS       T01002                                 
Symbol
Tpst1, R75054, Tango13a
Name
(RefSeq) protein-tyrosine sulfotransferase 1
  KO
K01021  protein-tyrosine sulfotransferase [EC:2.8.2.20]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    22021 (Tpst1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.20  protein-tyrosine sulfotransferase
     22021 (Tpst1)
SSDB
Motif
Pfam: Sulfotransfer_3 Sulfotransfer_1 Sulfotransfer_4
Other DBs
NCBI-GeneID: 22021
NCBI-ProteinID: NP_001123948
MGI: 1298231
Ensembl: ENSMUSG00000034118
UniProt: O70281 Q4FK50
Position
5:130102167..130164575
AA seq 370 aa
MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPARLENPKATVRAGLDIKAN
KTFTYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKE
KIRLDEAGVTDEVLDSAMQAFLLEVIVKHGEPAPYLCNKDPFALKSLTYLARLFPNAKFL
LMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYE
QLVLHPERWMRTLLKFLHIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALS
KWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKILENTRRVYKGEFQLPDFL
KEKPQTEQVE
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggttgggaagctgaagcagaacttactcttggcgtgtctggtgattagttctgtgacc
gtgttttacctgggccagcatgccatggagtgccatcaccgaatagaggaacgtagccag
ccagcccgactggagaaccccaaggcgactgtgcgagctggcctcgacatcaaagccaac
aaaacattcacctatcacaaagatatgcctttaatattcatcgggggtgtgcctcggagc
ggcaccacactcatgagggctatgctggacgcacatcctgacatccgctgtggagaggaa
accagggtcatccctcgaatcctggccctgaagcagatgtggtcccggtccagtaaagag
aagatccgcttggatgaggcgggtgtcacagatgaagtgctagattctgccatgcaagcc
ttccttctggaggtcattgttaaacatggggagccggcaccttatttatgtaacaaagat
ccgtttgccctgaaatccttgacttaccttgctaggttatttcccaatgccaaatttctc
ctgatggtccgagatggccgggcgtcagtacattcaatgatttctcggaaagttactata
gctggctttgacctgaacagctaccgggactgtctgaccaagtggaaccgggccatagaa
accatgtacaaccagtgtatggaagttggttataagaaatgcatgttggttcactatgaa
cagctcgtcttacaccctgaacggtggatgagaacgctcttaaagttcctccatattcca
tggaaccattccgttttgcaccatgaagaaatgatcgggaaagctgggggagtttctctg
tcaaaggtggaaagatcaacagaccaagtcatcaaacccgtcaacgtgggggcgctatcg
aagtgggttgggaagatacccccggacgtcttacaagacatggccgtgattgcacccatg
ctcgccaagcttggatatgacccatacgccaatcctcctaactacggaaaacctgacccc
aagatccttgaaaacaccaggagggtctataaaggagaatttcagctccctgactttctg
aaagaaaaaccccagacggagcaagtggagtaa

DBGET integrated database retrieval system