KEGG   Mus musculus (mouse): 22026Help
Entry
22026             CDS       T01002                                 

Gene name
Nr2c2, TAK1, Tr4, mKIAA4145
Definition
(RefSeq) nuclear receptor subfamily 2, group C, member 2
  KO
K08544  testicular receptor 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22026 (Nr2c2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    22026 (Nr2c2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    22026 (Nr2c2)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2C. Testicular receptor
   22026 (Nr2c2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 FAA_hydro_N_2
Motif
Other DBs
NCBI-GeneID: 22026
NCBI-ProteinID: NP_035760
MGI: 1352466
Ensembl: ENSMUSG00000005893
Vega: OTTMUSG00000022788
UniProt: P49117 Q3ZAS1
Position
6; 6 D1
AA seq 596 aa AA seqDB search
MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSSKQQFILTSPDGAG
TGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKADVQRPQVVEYCVVC
GDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSSQDCIINKHHRNRCQFCRLKKCLEM
GMKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLL
DPGMLVNIQQPLIREDGTVLLAADSKAETSQGALGTLANVVTSLANLSESLNNGDASEMQ
PEDQSASEITRAFDTLAKALNTTDSASPPSLADGIDASGGGSIHVISRDQSTPIIEVEGP
LLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCN
SMAKLDIDGYEYAYLKAIVLFSPDHPGLTGTSQIEKFQEKAQMELQDYVQKTYSEDTYRL
ARILVRLPALRLMSSNITEELFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcccctccccgcgcatccagataatttccaccgactctgcggtagcctcacct
cagcgcattcagattgtaacagaccagcagacaggacaaaagatccagatagtcaccgca
gtggatgcctctggatcctctaaacagcagttcatcctaaccagcccagatggagctgga
actgggaaggtgatcctggcttctccggaaacatccagtgccaagcagctcatattcacc
acctcggacaaccttgtccctggcaggatccagatcgtcacggattctgcttctgtggag
cgtttgctggggaaggcagacgtccagcggccccaggtggtggagtactgtgtggtctgt
ggcgacaaagcctctggccggcactatggggctgtcagttgtgaaggttgcaaaggtttc
ttcaaaaggagcgtgaggaagaatctgacctacagctgtcggagcagccaagactgcatc
atcaacaagcaccaccgtaaccgctgccagttctgccggctgaagaagtgcctggagatg
ggcatgaaaatggagtctgtacagagtgaacggaagccctttgatgtgcaacgggagaaa
ccaagcaattgtgctgcttccactgagaagatctatatccggaaagacctgagaagtcct
ctgatagccactcccacatttgtggcagacaaagatggagcaagacaaacaggtcttctt
gatccagggatgcttgtgaacatccaacagcctttgatacgtgaggatggtacagttctc
ctggccgcggattccaaggctgaaacaagccaaggagctctaggtacactggcaaatgta
gtgacctctttggccaacctgagtgaatctttgaacaacggtgatgcttcagaaatgcag
ccagaggaccagtctgcaagtgagattactcgggcatttgacaccttagcgaaagcactt
aataccacagatagtgcttcacctccaagcctggcagatgggatagatgctagtggagga
gggagtatccatgtcatcagcagagatcagtcaacacccatcattgaagttgaaggccct
ctcctttcagacacacatgtcacattcaagcttacaatgcccagtcctatgccagagtac
ctcaatgtacattacatctgtgagtctgcatcccgcctgcttttcctctccatgcactgg
gcaaggtcaatcccagccttccaggcacttggacaggactgtaataccagcctggtgagg
gcctgctggaatgagctcttcactcttggcctggcccagtgtgcccaggtcatgagtctc
tccaccatcctggcagccattgtcaaccacctacagaacagcatccaggaagataagctt
tctggtgaccggataaagcaagtgatggagcacatctggaagctgcaggagttctgtaac
agcatggcgaaactggatatagacggctatgagtacgcataccttaaagctatagttctc
tttagtcccgatcatccaggtttgacaggcacaagccagattgagaaatttcaggagaag
gcacagatggaattacaggactatgtgcagaaaacctactctgaagatacttacagattg
gccaggattcttgtccgcctaccagcactcaggctcatgagctccaacataacagaagaa
cttttttttactggtctcattggcaatgtttcaatagacagcataattccttacatcctc
aagatggagacagcagaatataatggccagatcactggagccagtctatag

DBGET integrated database retrieval system