KEGG   Mus musculus (mouse): 22027Help
Entry
22027             CDS       T01002                                 

Gene name
Hsp90b1, ERp99, GRP94, TA-3, Targ2, Tra-1, Tra1, endoplasmin, gp96
Definition
(RefSeq) heat shock protein 90, beta (Grp94), member 1
  KO
K09487  heat shock protein 90kDa beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04151  PI3K-Akt signaling pathway
mmu04657  IL-17 signaling pathway
mmu04915  Estrogen signaling pathway
mmu04918  Thyroid hormone synthesis
mmu05132  Salmonella infection
mmu05200  Pathways in cancer
mmu05215  Prostate cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22027 (Hsp90b1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    22027 (Hsp90b1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    22027 (Hsp90b1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    22027 (Hsp90b1)
   04918 Thyroid hormone synthesis
    22027 (Hsp90b1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22027 (Hsp90b1)
  09162 Cancer: specific types
   05215 Prostate cancer
    22027 (Hsp90b1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    22027 (Hsp90b1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    22027 (Hsp90b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    22027 (Hsp90b1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP90
   22027 (Hsp90b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518
Motif
Other DBs
NCBI-GeneID: 22027
NCBI-ProteinID: NP_035761
MGI: 98817
Ensembl: ENSMUSG00000020048
Vega: OTTMUSG00000020538
UniProt: P08113 Q3UAD6
Position
10 C1; 10 43.05 cM
AA seq 802 aa AA seqDB search
MRVLWVLGLCCVLLTFGFVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVRKYSQFINFPIYVWSSKTETVEEPLEEDEAAK
EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVMDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPEAQVEEEPEEEPEDTSEDAEDSEQDEGEE
MDAGTEEEEEETEKESTEKDEL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcctgtgggtgttgggcctctgctgtgtcctgctgaccttcgggttcgtcaga
gctgatgatgaagtcgacgtggatggcacagtggaagaggacctgggtaaaagccgagaa
ggctcaaggacagatgatgaagttgtgcagagagaggaagaagctattcagttggatggg
ttaaacgcatcacagataagagaacttagagaaaaatctgaaaagttcgccttccaagct
gaagtgaacaggatgatgaaacttatcatcaattctttgtataaaaataaagagattttc
ctgagagaactgatttcaaatgcttctgatgctttagacaagataaggctcatctcccta
actgatgaaaatgcactcgctggaaatgaggagttaacggtcaagattaagtgtgacaaa
gagaaaaacctgctgcatgtcacagacacgggtgtaggaatgactagagaggagttggtt
aaaaatctcggcaccatagccaaatctggaacaagcgagtttttaaacaaaatgacagaa
gctcaagaagatggtcagtcaacctctgaactgattggccagtttggtgtcggtttttat
tctgccttccttgtagcagataaggtcattgtcacatcgaaacacaacaatgatacccag
cacatctgggaatcagactccaatgaattctctgtaattgctgacccaagaggaaacaca
ctaggtcgtggaacaacaattactcttgtcttaaaagaagaagcatctgattaccttgaa
ttggacacaattaaaaatcttgtcaggaagtactctcagttcatcaactttcccatctac
gtgtggagtagcaagacagagactgttgaggagcccttggaagaagatgaagcagcaaaa
gaagagaaagaagaatctgatgatgaagctgcagtagaggaggaagaagaagaaaagaaa
ccaaaaactaagaaagttgaaaaaactgtgtgggattgggaacttatgaatgatatcaaa
ccaatatggcagagaccatccaaagaagtagaagaagacgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcttatatccacttcactgcagaaggggag
gtcaccttcaagtcgattttgtttgtacccacatctgcacctcgaggtctgtttgatgaa
tatggatctaagaagagtgattatattaagctgtatgtacgccgcgtattcatcacagat
gacttccatgatatgatgcccaaataccttaattttgtcaaaggtgttgtggattccgat
gatctccccctcaatgtttcccgtgagactcttcagcaacataaattgctcaaggtgatt
aggaagaagcttgtccgaaaaactctggacatgatcaagaagattgctgatgagaagtat
aacgacactttctggaaggagttcggcacgaatatcaagcttggtgtgattgaagaccac
tcaaatcgaacacggcttgctaaacttcttaggttccagtcttctcaccattcaactgac
attactagtttagaccagtatgtggaaagaatgaaggaaaaacaggacaaaatctacttc
atggctgggtcaagcagaaaggaggcggaatcttctccatttgttgagagacttctgaag
aagggctatgaagtcatttatctcacagagcctgtggatgaatactgcattcaggctctt
cccgagtttgatgggaagaggtttcagaatgttgccaaagaaggggtgaagtttgatgag
agtgagaaaactaaagaaagtcgggaagcaacagagaaggagtttgaacctctgctcaac
tggatgaaagataaggccctcaaggacaagatagaaaaggctgtggtgtcgcagcgcctc
acagagtctccctgtgctcttgtggccagtcagtatggatggtctggcaacatggagagg
atcatgaaggcacaagcataccagacgggcaaggacatctctacaaattactatgccagt
caaaagaaaacgttcgaaatcaatcctagacacccactgatcagagacatgttgcggcgg
attaaggaagatgaagatgacaagacagtcatggatcttgctgtagttttgtttgaaacg
gcaacacttcggtcaggatatcttctaccagacaccaaggcgtatggagatagaatagaa
agaatgcttcgcctcagtttaaacattgaccctgaagcacaggtggaggaagaaccagaa
gaagagcctgaagacacctcagaagacgcagaagactcagagcaggatgagggagaagag
atggatgcagggacagaagaagaagaggaggaaacagaaaaggaatctacagagaaggat
gaattgtaa

DBGET integrated database retrieval system