KEGG   Mus musculus (mouse): 22042Help
Entry
22042             CDS       T01002                                 

Gene name
Tfrc, 2610028K12Rik, CD71, E430033M20Rik, Mtvr1, TFR, TFR1, TR, Trfr, p90
Definition
(RefSeq) transferrin receptor
  KO
K06503  transferrin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04216  Ferroptosis
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    22042 (Tfrc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    22042 (Tfrc)
   04145 Phagosome
    22042 (Tfrc)
  09143 Cell growth and death
   04216 Ferroptosis
    22042 (Tfrc)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    22042 (Tfrc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22042 (Tfrc)
   04090 CD molecules [BR:mmu04090]
    22042 (Tfrc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22042 (Tfrc)
  Exosomal proteins of colorectal cancer cells
   22042 (Tfrc)
CD molecules [BR:mmu04090]
 Proteins
  22042 (Tfrc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M28 PA TFR_dimer DUF3149
Motif
Other DBs
NCBI-GeneID: 22042
NCBI-ProteinID: NP_035768
MGI: 98822
Ensembl: ENSMUSG00000022797
Vega: OTTMUSG00000026922
UniProt: Q62351 Q542D9
Position
16 B3; 16 23.06 cM
AA seq 763 aa AA seqDB search
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAADEEENADNNMKASVRKPK
RFNGRLCFAAIALVIFFLIGFMSGYLGYCKRVEQKEECVKLAETEETDKSETMETEDVPT
SSRLYWADLKTLLSEKLNSIEFADTIKQLSQNTYTPREAGSQKDESLAYYIENQFHEFKF
SKVWRDEHYVKIQVKSSIGQNMVTIVQSNGNLDPVESPEGYVAFSKPTEVSGKLVHANFG
TKKDFEELSYSVNGSLVIVRAGEITFAEKVANAQSFNAIGVLIYMDKNKFPVVEADLALF
GHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTISRAAAEKLFGKMEGSCPARWN
IDSSCKLELSQNQNVKLIVKNVLKERRILNIFGVIKGYEEPDRYVVVGAQRDALGAGVAA
KSSVGTGLLLKLAQVFSDMISKDGFRPSRSIIFASWTAGDFGAVGATEWLEGYLSSLHLK
AFTYINLDKVVLGTSNFKVSASPLLYTLMGKIMQDVKHPVDGKSLYRDSNWISKVEKLSF
DNAAYPFLAYSGIPAVSFCFCEDADYPYLGTRLDTYEALTQKVPQLNQMVRTAAEVAGQL
IIKLTHDVELNLDYEMYNSKLLSFMKDLNQFKTDIRDMGLSLQWLYSARGDYFRATSRLT
TDFHNAEKTNRFVMREINDRIMKVEYHFLSPYVSPRESPFRHIFWGSGSHTLSALVENLK
LRQKNITAFNETLFRNQLALATWTIQGVANALSGDIWNIDNEF
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgatggatcaagccagatcagcattctctaacttgtttggtggggaaccattgtcatac
acccggtttagccttgctcggcaagtagatggagataacagtcatgtggagatgaaactg
gctgcagatgaagaagaaaatgccgacaataacatgaaggctagtgtcagaaaacccaag
aggtttaatggaagactctgctttgcagctattgcactagtcattttcttcttgattgga
ttcatgagtggctacctgggctattgtaagcgtgtagaacaaaaagaggagtgtgtgaaa
ctggctgaaacggaggagacagacaagtcagaaaccatggaaacagaggatgttcctaca
tcatctcgcttatattgggcagacctcaaaacactgttgtcagagaagttgaactccata
gagtttgctgacaccatcaagcagctgagccagaatacatacactcctcgtgaggctgga
tctcaaaaagatgaaagtcttgcctattatattgaaaatcagttccatgaatttaaattc
agcaaagtctggcgagatgaacactatgtgaagattcaagtgaaaagcagcattggtcaa
aacatggtgaccatagtgcagtcaaatggtaacttagacccagtggagtctcccgagggt
tatgtggcattcagtaaacctacagaagtttctggtaaactggtccatgctaattttggc
actaaaaaggactttgaagaactaagttattctgtgaatggatctttagtgattgttaga
gcaggggaaattacttttgcagaaaaggttgcaaatgcccaaagctttaatgcaattggt
gtcctcatatacatggacaagaataaattccccgttgttgaggcagaccttgcactcttt
ggacatgctcatctaggaactggtgatccatacacacctggctttccttctttcaatcat
actcagtttccgccatctcagtcatcagggttgcctaatatacctgtgcaaacaatctca
agagctgctgcagaaaagctatttggaaaaatggaaggaagctgtcctgctagatggaac
atagattcttcatgtaagctggaactttcacagaatcaaaatgtgaagctcattgtgaaa
aacgtactgaaagaaagaagaatacttaacatctttggagttattaaaggttatgaggaa
ccagaccgttatgttgtagtaggagcccagagagacgctttgggtgctggtgttgcggcg
aagtccagtgtgggaacaggtcttctgttgaaacttgcccaagtattctcagatatgatt
tcaaaagatggatttagacccagcagaagtataatctttgccagctggactgcaggcgac
tttggagctgttggtgccactgagtggttggagggatacctttcatctttgcatttaaaa
gctttcacttatattaatttggataaagttgtccttggtactagtaacttcaaagtttct
gccagccccttattatatacacttatgggaaagataatgcaagatgtaaagcatccagtt
gatggaaaatctctatatagagacagcaattggattagcaaagttgagaaactttccttt
gacaatgctgcatatcctttccttgcatattctggaatcccagcagtttctttttgtttt
tgtgaggatgcagactatccttatttgggcactagattggatacctatgaggcattgact
cagaaagttcctcagctcaaccaaatggttcgtacagcagcggaagtggctggtcagctc
attattaaacttacccatgacgttgaattgaacctggactatgagatgtataacagcaaa
ctactgtcatttatgaaggatctgaaccagttcaaaacagatatcagggatatgggtcta
agtctacagtggctgtattccgctcgtggagactacttccgtgctacttctagactaaca
actgattttcataatgctgagaaaacaaacagatttgtcatgagggaaatcaatgatcgt
attatgaaagtggagtatcacttcctgtcgccctatgtatctccaagagagtctcctttc
cgacatatcttctggggctctggctctcacactctctcagctttagtggagaacttgaag
cttcgtcaaaaaaatattactgcttttaatgaaaccctcttcagaaaccagttggccctg
gctacttggactattcagggagtcgcaaatgccctctctggtgacatttggaatattgac
aatgagttttaa

DBGET integrated database retrieval system