KEGG   Mus musculus (mouse): 22044Help
Entry
22044             CDS       T01002                                 

Gene name
Trh, Pro-TRH, Trf
Definition
(RefSeq) thyrotropin releasing hormone
  KO
K05253  thyrotropin-releasing hormone
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    22044 (Trh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRH
Motif
Other DBs
NCBI-GeneID: 22044
NCBI-ProteinID: NP_033452
MGI: 98823
Ensembl: ENSMUSG00000005892
Vega: OTTMUSG00000024415
UniProt: Q62361
Position
6 D1; 6 41.03 cM
AA seq 256 aa AA seqDB search
MQGPWLMMALALIFVLTGIPKSCALLEAAQEEGAVTPDLPGLEKVQVRPERRFLRKDLQR
VRGDLGAALDSWITKRQHPGKREEKEEDVEAEERGDLGEVGAWRPHKRQHPGRRANQDKD
SWSDEGDSDWLPPSWLPDFFLDSWFSDAPQVKRQHPGRRSFPWMESDVTKRQHPGRRFID
PELQRSWEETEGEEGGLMPEKRQHPGKRAVGHPCGPQGICGQTGLLQLLGDLSRGQETLA
KQTPQLEAWVREPLEE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaccttggctgatgatggctctggctttgatcttcgtgctaactggtatcccc
aaatcctgcgccttgctggaagcagcccaggaggaaggtgctgtgactcctgaccttcca
ggcctggagaaagtccaggtccggccagaacgtcgattcttgaggaaagacctccagcgt
gtgcgaggggaccttggtgctgccttagattcctggatcacaaaacgccagcatccgggc
aaaagggaggagaaggaggaagacgttgaagccgaagagaggggagatttgggagaagtg
ggagcctggagaccccacaaacgacagcaccctggccgacgtgccaaccaagacaaggat
tcatggtcagatgagggggacagtgactggctgcccccgtcctggctaccagatttcttt
ctggattcctggttctcagatgccccccaagtcaagcggcagcaccctggcaggcgatcc
ttcccctggatggagtctgatgtcaccaagaggcagcatccaggccggaggttcatagat
cctgagctccaaagaagctgggaagaaacagagggagaggagggtggcttaatgcctgag
aaacgtcagcatcctggcaaaagggcagtgggtcacccttgtgggccccaggggatttgt
ggccaaacaggcctgctccagcttctaggtgacctgagtaggggccaggagaccctggca
aagcaaaccccacaactggaagcctgggtcagggaacctctggaggagtaa

DBGET integrated database retrieval system