KEGG   Mus musculus (mouse): 22045Help
Entry
22045             CDS       T01002                                 

Gene name
Trhr, TRH-R1
Definition
(RefSeq) thyrotropin releasing hormone receptor
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    22045 (Trhr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    22045 (Trhr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    22045 (Trhr)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Thyrotropin-releasing hormone (TRH)
    22045 (Trhr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 22045
NCBI-ProteinID: NP_038724
MGI: 98824
Ensembl: ENSMUSG00000038760
UniProt: P21761 Q32MS1
Position
15 B3.2; 15 16.82 cM
AA seq 393 aa AA seqDB search
MENDTVSEMNQTELQPQAAVALEYQVVTILLVVIICGLGIVGNIMVVLVVMRTKHMRTPT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVVSCG
YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKNDSIH
QNKNLNLNATNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKAANYSVALNYSVIKES
DRFSTELEDITVTDTYVSTTKVSFDDTCLASEN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgatactgtcagtgaaatgaaccaaaccgagctccagccacaagcagctgtg
gccctcgagtaccaggtggttaccatcttacttgtggtcattatttgtggactgggcatt
gtgggcaacatcatggtagtcctggtggtcatgagaacaaagcacatgagaacccctaca
aactgttacctggtaagtctggctgtggcagatctcatggttctggtggctgcaggcctc
cccaacataaccgacagtatctatggttcctgggtctatggctatgttggctgcctctgc
attacatatctccagtacctaggcattaatgcatcttcatgttcaataacggcctttacc
attgaaaggtacatagcaatctgtcaccccatcaaagcccagtttctctgcacgttttcc
agagccaaaaaaatcatcatctttgtctgggccttcacatccatttactgtatgctctgg
ttcttcctgctggatctcaacatcagcacctacaaaaacgctgttgtggtttcctgtggc
tacaagatctccaggaactactactcacctatttacctaatggactttggtgtcttttat
gttgtgccaatgatcctggccactgtgctttatggatttatagctagaatcctcttctta
aaccccattccttcagaccctaaagaaaactctaagatgtggaaaaatgactcaatccat
cagaacaagaatttgaatttaaatgccaccaacagatgcttcaacagcactgtatcttcc
aggaagcaggtcaccaagatgctcgcagtggttgtaattctgtttgcccttttatggatg
ccctacaggactcttgtggttgtcaactcatttctctccagccctttccaggaaaattgg
ttcttgctcttttgcagaatttgcatttatctcaacagtgccatcaacccagtgatttac
aacctcatgtctcagaaatttcgtgcagccttcaggaagctctgcaattgcaagcagaag
cccacagaaaaagctgctaactacagtgtggccctaaattacagtgtcatcaaggagtca
gaccgcttcagcacagagctagaagatatcaccgtcaccgatacgtatgtgtcaaccaca
aaagtgtcctttgatgacacctgcttggcctctgagaactaa

DBGET integrated database retrieval system