KEGG   Mus musculus (mouse): 22063Help
Entry
22063             CDS       T01002                                 

Gene name
Trpc1, Mtrp1, Trp1, Trrp1
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 1
  KO
K04964  transient receptor potential cation channel subfamily C member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu04724  Glutamatergic synapse
mmu04726  Serotonergic synapse
mmu04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    22063 (Trpc1)
  09156 Nervous system
   04724 Glutamatergic synapse
    22063 (Trpc1)
   04726 Serotonergic synapse
    22063 (Trpc1)
  09158 Development
   04360 Axon guidance
    22063 (Trpc1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    22063 (Trpc1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   22063 (Trpc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRP_2 Ion_trans Ank_2 Ank_4
Motif
Other DBs
NCBI-GeneID: 22063
NCBI-ProteinID: NP_035773
MGI: 109528
Ensembl: ENSMUSG00000032839
Vega: OTTMUSG00000047293
UniProt: Q61056 B2RPS7
Position
9 E3.3; 9 50.2 cM
AA seq 809 aa AA seqDB search
MGAPPPSPGLPPSWAAMMAALYPSTDLSGVSSSSLPSSPSSSSPNEVMALKDVREVKEEN
TLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENESLDILQLLL
DYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVI
LAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPA
LIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEV
ILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRR
KPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLY
SLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNS
LYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILG
PLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTF
HSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAM
LHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICS
HTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNEL
RQDLSKFRNEIRDLLGFRTSKYAMFYPRN
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgggggccccgcctccgtctcctggcctgcccccgtcgtgggccgcgatgatggcggcc
ctgtacccgagcacggacctctcgggcgtctcctcctcctccctgccttcctccccatcc
tcctcgtcgcccaacgaagtgatggcgctgaaggatgtgcgagaggtgaaggaggagaac
accttgaatgagaagcttttcttgctggcgtgcgacaagggtgactattatatggttaaa
aagattttggaggaaaacagttcaggtgacttgaacataaattgcgtagatgtgcttggg
agaaatgctgttaccataactattgaaaacgaaagcttggacatactgcagctgcttttg
gactacggttgtcagtccgcagatgcacttttggtggcaatcgactctgaagtagtggga
gctgttgatatactacttaatcatcggccaaaacgatcatcaagaccaaccattgtaaaa
cttatggaacgaattcagaatccagaatattcaacaacgatggatgtcgcacctgttatt
ttagctgctcatcgtaacaactatgaaatccttacaatgcttttaaagcaggatgtgtct
ttgcccaagccccatgctgttggctgtgaatgcacactgtgttctgcaaaaaacaagaag
gacagcctcagacattccaggtttcgtcttgatatctatagatgtctggccagtccagct
ctgataatgttaacagaggaagatccaattctgagagcgtttgaacttagtgctgactta
aaggaactcagccttgtggaggtggaattcaggaatgattatgaagagctagcccgtcag
tgcaaaatgtttgctaaagatttgctcgcacaagcccggaattctcgtgaactggaagtt
atcctgaaccatacatctagcgatgagcctcttgacaaacgaggactactagaagaaaga
atgaacttaagtcgtctgaaacttgctatcaaatataaccagaaggagtttgtctcccag
tcaaattgccagcagttcctgaacacggtttggtttggacagatgtcaggttaccgccgt
aagcccacctgtaagaagataatgactgttttgacagttggcatcttctggccagttttg
tcactatgctatttgatagctcccaaatctcaatttggcagaatcattcacacacctttc
atgaaattcattattcatggagcatcgtatttcacattcttgctgttactaaatctctac
tcacttgtctacaatgaggacaagaaaaatacaatgggaccagccctggagagaatagat
taccttctcatactgtggattattgggatgatttggtcagacattaagagactgtggtat
gaagggttggaagacttcctagaagaatcgcgtaaccagctcagctttgttatgaattcc
ctttacttggcaacctttgccctcaaagtggtggctcacaacaagtttcatgactttgct
gaccggaaggactgggatgcattccaccccacgcttgtagcagaagggctttttgctttt
gcaaacgttctgagttaccttcgactcttttttatgtatacaaccagctctattttgggc
ccactgcagatttcaatgggacagatgttacaagattttgggaaatttctgggaatgttc
ctccttgttctgttttccttcacgattggactgactcagctctatgacaaagggtacact
tccaaagagcagaaggactgtgtgggcatcttctgcgaacagcaaagcaatgacaccttc
cactcgttcattggcacctgctttgctctgttctggtacatcttctccttagcgcacgtg
gccatctttgtcaccaggtttagctatggggaagagctgcagtccttcgttggagctgtg
attgttggaacttacaatgttgtggttgtgattgtgctgacgaagctgctcgtggcgatg
cttcacaagagcttccagctgatagcaaatcatgaggataaagaatggaagtttgctcga
gcaaagctatggcttagctactttgatgacaaatgtacactgcccccacctttcaacatt
attccttctccaaagacgatctgctatatgatcagtagcctcagtaaatggatttgctcg
catacctcgaaaggcaaggtcaaacgtcaaaacagtttaaaggagtggagaaacttgaag
caaaagagagacgagaactaccagaaggtgatgtgctgcctggtgcaccgctacctgacg
tccatgcgacagaagatgcagagcacagaccaggccaccgtggagaacctcaatgaactg
cgccaagatctgtcaaaattccgaaatgaaataagggatttgcttggctttcggacttct
aaatatgctatgttttatccaagaaattaa

DBGET integrated database retrieval system