KEGG   Mus musculus (mouse): 22064
Entry
22064             CDS       T01002                                 

Gene name
Trpc2, 3010009O07Rik, AI115608, TRP, TRPC, TRPC2a, TRPC2b, Trrp2, mTr, mTrp2, smTRPC2, tr, trp2
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 2
  KO
K04965  transient receptor potential cation channel subfamily C member 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    22064 (Trpc2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   22064 (Trpc2)
SSDB
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank
Other DBs
NCBI-GeneID: 22064
NCBI-ProteinID: NP_001103367
MGI: 109527
Ensembl: ENSMUSG00000100254
Vega: OTTMUSG00000022733
UniProt: Q9R244
Position
7 E2; 7 54.71 cM
AA seq 890 aa
MDPLSPQPNWTEIVNKKLKFPPTLLRAIQEGQLGLVQQLLESSSDASGAGPGGPLRNVEE
SEDRSWREALNLAIRLGHEVITDVLLANVKFDFRQIHEALLVAVDTNQPAVVRRLLARLE
REKGRKVDTKSFSLAFFDSSIDGSRFAPGVTPLTLACQKDLYEIAQLLMDQGHTIARPHP
VSCACLECSNARRYDLLKFSLSRINTYRGIASRAHLSLASEDAMLAAFQLSRELRRLARK
EPEFKPQYIALESLCQDYGFELLGMCRNQSEVTAVLNDLGEDSETEPEAEGLGQAFEEGI
PNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNLAGWRGSTTIWKLFVAFLIFLTMPFL
CIGYWLAPKSQLGRLLKIPVLKFLLHSASYLWFLIFLLGESLVMETQLSTFKGRSQSVWE
TSLHMIWVTGFLWFECKEVWIEGLRSYLLDWWNFLDVVILSLYLASFALRLLLAGLAYMH
CRDASDSTTCRYFTTAERSEWRTEDPQFLAEVLFAVTSMLSFTRLAYILPAHESLGTLQI
SIGKMIDDMIRFMFILMIILTAFLCGLNNIYVPYQESEKLGNFNETFQFLFWTMFGMEEH
TVVDMPQFLVPEFVGRAMYGIFTIVMVIVLLNMLIAMITNSFQKIEDDADVEWKFARSKL
YLSYFREGLTLPVPFNILPSPKAAFYLVRRIFRFLCCGSSCCKAKKSDYPPIGTFTNPGA
RAGSAGEGERVSYRLRVIKALVQRYIETARREFEETRRKDLGNRLTELTKTVSRLQSEVA
SVQKNLAAGGAPRPPDGASILSRYITRVRNSFQNLGPPTSDTPAELTMPGIVETEVSLGD
GLDGTGEAGAPAPGEPGSSSSAHVLVHREQEAEGSGDLLLEGDLETKGES
NT seq 2673 nt   +upstreamnt  +downstreamnt
atggaccccctttcgccacagcccaactggactgagattgtgaacaaaaagctcaaattc
ccccccacactcctgcgtgccatccaggagggccagctgggtcttgtgcagcagctgctg
gaatccagttccgatgcctcgggtgctgggccaggtggtcctctgcggaatgtggaagag
tctgaggaccgctcctggagggaagccctcaacctggccatccgcctgggccacgaggtc
atcactgatgttctgctggccaatgtcaaattcgactttcggcagatccacgaagccctg
ctagtggctgtggacacaaaccagccagcagtggtgcgtcgcctgctagcgcggctggag
cgggagaaaggtcgaaaagtagacaccaagtctttctctctagccttctttgactcatcg
attgatggctcccgctttgcccctggtgtcactccactcacactggcctgccagaaggac
ctgtatgagattgcccagctgcttatggaccagggccataccattgctcggccccaccca
gtttcctgtgcctgcctcgagtgcagcaatgcccgccgatacgacctgctgaagttctca
ctatcccgaatcaacacctaccgaggcattgcaagccgggctcacctctcgctggccagt
gaggatgccatgctggccgcttttcagctcagccgggagctcaggcgccttgcacgaaag
gagcctgagtttaagcctcagtacattgccctggagtctctctgccaggactatggcttc
gagttgctgggcatgtgccgaaatcagagtgaggtcaccgcagtgctcaatgacctgggt
gaggatagtgagactgagcctgaggctgagggcctgggtcaggcctttgaggagggcatc
cccaacctggcaagactgcggttggctgtcaactacaaccagaaacagtttgtagcacat
cccatctgccagcaagttctgtcttccatctggtgtgggaacctggctggctggcgtgga
agcaccaccatctggaagctctttgttgccttcctcatcttcctcaccatgcccttcctc
tgcattggctactggctggcgcccaagtcccagctgggccgcctgctgaagatcccggtg
ctgaagttcctgctgcattctgcctcctacctgtggttccttatcttcttgctgggagag
tctctggtcatggagacccagctgagcaccttcaaaggccgcagccagagtgtctgggag
acttcactacatatgatctgggtcacaggcttcctatggtttgaatgcaaggaggtgtgg
atcgagggcttgcggagctacctcctggactggtggaacttcctggacgtggtcatcctg
tccctgtacttggcatcctttgcactgcgcctcctcctggctgggcttgcctacatgcac
tgccgtgatgcctcagacagcaccacctgccgctatttcaccacagctgagagaagtgag
tggcgtacagaggacccccagtttctggctgaggtgctctttgctgtcaccagcatgctc
agcttcacccgactggcatatattctgccagctcacgaatcgctgggcacactgcagatc
tccatcggcaagatgattgacgacatgatccggttcatgttcatcctcatgatcatcctg
actgccttcctctgtggcctcaacaacatctatgtgccctaccaggaatccgagaagcta
ggcaatttcaacgaaacgttccagtttctcttttggaccatgttcggcatggaagagcac
acagtggtggacatgcctcagttcctggtgcctgagttcgtgggcagggccatgtacggc
atctttaccatcgtcatggtcattgtgctacttaacatgcttattgccatgatcaccaac
tccttccagaagatcgaggatgatgctgatgtggagtggaagtttgctcgctccaagctc
tacctgtcctacttccgagagggtctgacgctgcctgtgccctttaacatcctgccatcc
ccaaaggccgccttctacctcgtcaggagaattttccggttcctttgctgtggctcctcc
tgctgcaaagccaagaagtcggactacccgcccatcgggacctttaccaaccccggggca
agggcgggctccgccggggaaggagaacgcgtgtcctaccgccttcgagtcatcaaggct
ctggtgcagcgctacatagagactgcccggcgcgagttcgaggagacccgtcggaaagac
ctgggcaacagactgacagagctgaccaagactgtgtctcgactgcaaagcgaggtggcc
agtgtgcagaagaacctggcggcgggaggggcaccacggcctccggatggtgccagcatc
ctcagtagatacatcacccgagtgcgcaacagcttccagaacctgggcccccctacctct
gacaccccagcagagctgactatgcctgggattgtggagaccgaagtctctttaggagat
ggccttgatggcacaggtgaagctggagctcccgctcctggagagcccggctcttcctcc
tctgcccatgtgctggttcacagggagcaagaagcagaggggtcaggggacttgctcctg
gaaggagatctggagaccaagggcgagtcctaa

DBGET integrated database retrieval system