KEGG   Mus musculus (mouse): 22065Help
Entry
22065             CDS       T01002                                 

Gene name
Trpc3, Mwk, Trcp3, Trp3, Trrp3
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 3
  KO
K04966  transient receptor potential cation channel subfamily C member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    22065 (Trpc3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    22065 (Trpc3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   22065 (Trpc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank_5 Ank_4
Motif
Other DBs
NCBI-GeneID: 22065
NCBI-ProteinID: NP_062383
MGI: 109526
Ensembl: ENSMUSG00000027716
Vega: OTTMUSG00000006507
UniProt: B1ATV3 Q8BNT8 Q8CCQ1
Position
3 B; 3 17.93 cM
AA seq 910 aa AA seqDB search
MSTKVKKCREPARVTLPAPEEEEDGEAEGGESQRRRRGWRGVNGGLEPPCPRAPPSPGPD
ASSEGSPSRWRTAGMRDKGRRQAVRGPAFMFGARGPSLTAEEERFLDAAEYGNIPVVRKM
LEESRTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIV
EAILGHPGFAASRRLTLSPCEQELRDDDFYAYDEDGTRFSPDITPIILAAHCHKYEVVHL
LLLKGARIERPHDYFCRCSDCAEKQRLDAFSHSRSRINAYKGLASPAYLSLSSEDPVLTA
LELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLE
RHGHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVAL
GLPFLAIGYWIAPCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNIT
VIDYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYIVQLWNVLDFGMLS
IFIAAFTARFLAFLQATKAQQYVDSHVQESDLSEVTLPPEVQYFTYARDKWLPSDPQIIS
EGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFLAFMIGMFIL
YSYYLGAKVNPAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTM
VVVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVY
FIMRITNFSKCRRRRLQKDLELGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQI
MKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSE
KLNPSVLRCE
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaaggtcaagaagtgccgggagcccgcgagggtgaccttgcccgctccggag
gaggaggaggatggcgaggccgagggaggcgagtcgcagcgccgccgccggggctggagg
ggcgtcaacggcgggctggagccgccctgcccgcgcgcgccgccgtccccggggcccgac
gcgtcgtcggagggcagcccatccaggtggcgcactgcggggatgcgtgacaagggccgg
cgccaggcagtgcgtggcccggccttcatgttcggtgctcgtgggcccagcctcacagct
gaggaggagcgcttcctggatgctgcggagtacggcaacatccctgtggtgcgcaagatg
ctggaggagtctcgcacgctcaatgtcaactgcgtggactacatgggccagaacgcactg
cagctggctgtaggcaatgagcatctggaggtgaccgagctgctgctgaagaaggagaac
ctggcgcggatcggtgatgcgctgctgctagccatcagcaagggctatgtgcgcatcgtg
gaggccatcctgggccacccaggctttgcagccagccggcgcctgaccctcagcccttgc
gagcaagaactgcgagatgatgacttctatgcttacgacgaggatggcacacgcttctcg
cctgacatcacgcccatcatcctggctgcacactgccataagtacgaggtggtgcacctg
ctgctactcaagggtgcacgcatcgagaggccacacgactacttctgtcgctgctctgac
tgcgctgagaaacaaaggcttgacgccttcagccactcaaggtctaggatcaatgcctac
aagggactggccagcccagcatacttgtcgctgtccagcgaggaccccgtgctcacagca
ctggagctcagcaatgagctggccaagctggccaacatagagaaggagttcaagaatgac
tacaggaaactctccatgcaatgcaaagacttcgtagtgggtgtgctggacctgtgtcgg
gactcggaggaggtggaagccattctgaatggagatctggaatcagccgagcccctggaa
agacacgggcacaaagcgtcactgagtcgtgtcaaacttgccattaagtatgaagtcaaa
aagtttgtggctcaccccaactgccaacagcagcttttgacaatctggtatgagaacctt
tccggcctccgggagcagaccatcgctatcaagtgtctggtcgtgttggtcgtggccttg
ggtcttccattcctcgccatcggctattggattgcaccttgtagcaggctggggaagatt
cttcgaagccccttcatgaagtttgtggcccacgctgcctccttcatcatctttctgggt
ctgcttgtattcaacgcctcggacagatttgaaggcatcaccacgctgccaaacatcact
gttatcgactaccccaagcaaatcttcagggtgaagaccacccagttcacgtggacggaa
atgttaattatggtctgggttcttgggatgatgtggtctgagtgcaaggagctgtggctg
gaggggccccgggagtacatcgtgcagttgtggaatgtgcttgatttcggcatgctctcc
atcttcatcgccgcgttcacagccaggttcctcgctttcctgcaggccacgaaggcgcag
cagtatgtggatagtcacgtgcaggagagcgatctgagcgaagtcacgctcccacctgag
gttcaatatttcacctatgctagagacaaatggctcccctcagaccctcagatcatatct
gaagggctctatgccatagctgtggtgctcagcttctcccggattgcgtacatcctccct
gcaaacgagagctttgggcccttgcagatctctcttggaaggactgtgaaggacatattc
aagttcatggttctcttcattatggtgttcctggctttcatgattggcatgttcatactt
tattcttactaccttggggccaaagtaaatcctgcttttaccacggttgaagaaagtttc
aagactttgttttggtccatatttggactgtctgaagtgacttctgttgtcctcaaatat
gatcacaaattcatagagaatattggctatgttctttatgggatatataatgtaactatg
gtggtcgttttactcaacatgctaattgctatgattaatagctcataccaagagatcgag
gatgacagtgatgtagaatggaagtttgctcgttccaaactttggctctcctacttcgat
gatggaaaaacattacctccacccttcagtctggtccctagtccaaaatcatttgtttac
ttcatcatgaggatcactaacttttccaaatgcaggaggagaagactgcagaaggatctg
gaactgggcatgggtaactcaaagtccaggttaaacctcttcacacagtctaactcgaga
gtttttgaatcacacagttttaacagcattctcaatcagccaacacgatatcagcagata
atgaaaagactcataaaacggtatgttttgaaagcacaagtagacaaagaaaacgatgag
gtgaatgaaggtgaactgaaagaaatcaagcaggatatctccagccttcgttatgaactt
ttagaagataagagccaagcgacggaggaattagccatcttgattcataaactcagtgag
aaactgaaccccagtgtgctgagatgtgagtga

DBGET integrated database retrieval system