KEGG   Mus musculus (mouse): 22066Help
Entry
22066             CDS       T01002                                 

Gene name
Trpc4, CCE1, STRPC4, Trp4, Trrp4
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 4
  KO
K04967  transient receptor potential cation channel subfamily C member 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    22066 (Trpc4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    22066 (Trpc4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   22066 (Trpc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 Ank_4 Ank_2 Ank_3 Ank PKD_channel Cadherin_2
Motif
Other DBs
NCBI-GeneID: 22066
NCBI-ProteinID: NP_058680
MGI: 109525
Ensembl: ENSMUSG00000027748
Vega: OTTMUSG00000053764
UniProt: Q9QUQ5 Q0VB97 Q8BNT2
Structure
PDB: 

Position
3 C; 3 25.43 cM
AA seq 974 aa AA seqDB search
MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFK
ININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKK
PSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVE
CVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSE
YEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEF
VAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIR
KPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ
MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEAL
FAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFY
YEETKGLSCKGIRCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATM
FGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVI
PSPKSLWYLVKWIWTHLCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAA
MIREAKTEEGLTEENVKELKQDISSFRFEVLGLLRGSKLSTIQSANAASSADSDEKSQSE
GNGKDKRKNLSLFDLTTLIHPRSAAIASERHNLSNGSALVVQEPPREKQRKVNFVADIKN
FGLFHRRSKQNAAEQNANQIFSVSEEITRQQAAGALERNIELESKGLASRGDRSIPGLNE
QCVLVDHRERNTDTLGLQVGKRVCSTFKSEKVVVEDTVPIIPKEKHAHEEDSSIDYDLSP
TDTAAHEDYVTTRL
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttctattacaaaagaaatgtcaacgccccctacagagaccgcatcccactg
aggattgtcagagcagaatctgagctctcaccatcagagaaagcctacttgaatgctgtg
gagaagggggactatgcaagcgtcaagaagtctctggaggaagctgagatttattttaaa
atcaacattaactgcatcgaccccctgggaaggaccgccctcctcattgccattgaaaat
gagaatctggagcttattgaactattgttgagtttcaatgtctatgtaggcgatgcgctg
cttcacgccatcagaaaagaggtggttggagccgtggagctactgctgaaccacaaaaag
ccaagtggagagaagcaggtgcctcccattctccttgataaacagttctctgaattcact
ccggacatcacacccatcatcttggctgcacatacaaataattacgagataatcaaactt
ttggttcagaaaggtgtctcagtgcccagaccccacgaggtccgctgtaactgtgttgag
tgtgtctccagctcggatgtggacagcctcaggcattcacggtccaggctcaacatctac
aaggccttggccagcccctcgctcattgccctgtcaagcgaagaccctttccttactgcc
tttcagttaagttgggagctgcaagaactcagcaaggtggagaacgaattcaagtcggag
tatgaggagctgtctagacagtgcaaacaatttgccaaggacctcctagatcagacacgg
agttccagagagctggaaatcattcttaattaccgtgatgacaatagtctgatcgaagaa
cagagtggaaatgatcttgcaaggctaaaattagccattaagtaccgtcaaaaagagttt
gttgctcagcccaactgccagcagctgctcgcttcccgctggtacgatgagttcccaggc
tggaggagaagacactgggcggtgaagatggtgacgtgtttcataataggactactcttc
cccgtcttctccgtgtgctacctgatagctcccaaaagcccacttggactgttcatcaga
aagccatttatcaagtttatctgccacacagcctcctatctgacctttttgtttctgctg
ctgctagcctctcagcacatcgacaggtcagacttgaacaggcaaggtccaccaccaacc
atcgtggagtggatgatattaccgtgggtcctgggttttatatggggagagattaaacag
atgtgggatggcggactccaggattacatccatgactggtggaatctaatggactttgtg
atgaactccttgtatctggcaacaatctccttgaagattgtcgcgtttgtaaagtacagt
gctctgaacccacgggaatcatgggacatgtggcaccccaccctggtggcagaggcatta
tttgctattgcaaacatcttcagttccctccgcctgatctctctgttcactgccaattct
cacctggggcctctgcagatatctctgggaaggatgcttctggacatcctgaagttcttg
ttcatctactgcctcgtgctgctagcttttgcaaatggcctaaatcagctgtacttttac
tatgaagaaacaaaggggctaagctgcaaaggcatccggtgcgagaaacagaacaacgcg
ttttccacgttattcgagacactacagtccctgttttggtcaatatttggactcatcaat
ctctatgttaccaatgtcaaagcccagcacgagttcactgagtttgttggggccaccatg
tttggcacatataatgtcatctctctggttgtcctgctgaacatgttaattgctatgatg
aataattcttaccaactaattgccgaccatgcagatatagaatggaaatttgctcgaaca
aagctttggatgagctactttgaagaaggaggtaccctgcctacacctttcaatgtcatc
ccaagccccaagtccctgtggtacctggtcaagtggatatggacacacttatgtaagaaa
aaaatgagaaggaagccagaaagcttcgggacaattgggcggcgtgctgctgataacttg
agaagacatcaccaataccaagaggtgatgaggaacctggtgaagcggtacgtggcagcc
atgatcagagaggcaaaaaccgaagaaggcttgacggaggagaatgttaaggaactaaag
caagacatttctagcttccgcttcgaagttctgggattgctcagaggaagcaagctctct
acaatacagtcagccaacgcggcgagttcagcggactccgacgagaagagccagagcgaa
ggtaatggcaaggacaagagaaagaatctcagcctctttgatttaaccactctgatccac
ccgcggtcggcagccattgcctccgagagacataacctaagcaatggttccgccctggtg
gtgcaggagccgcccagggagaagcagaggaaagtgaattttgtggctgatatcaaaaac
ttcgggttatttcatagacggtcaaaacaaaatgctgctgagcaaaacgcaaaccaaatc
ttctctgtttcagaagaaattactcgtcaacaggcggcaggagcacttgagcgaaatatc
gaactggaatccaaaggattagcttcacggggtgaccgcagcattcctggtctcaatgaa
cagtgtgtgctagtagaccatagagaaaggaatacggacactttgggtttacaggtaggc
aagagagtgtgctccaccttcaagtcggagaaggtggtggtggaagacaccgtccctatt
ataccaaaggagaaacacgcccacgaggaggactcgagcatagactatgacttaagcccc
acggacacagctgcccacgaagattatgtgaccacaagattgtga

DBGET integrated database retrieval system