KEGG   Mus musculus (mouse): 22084
Entry
22084             CDS       T01002                                 

Gene name
Tsc2, Na, Nafld, Tcs2, tube
Definition
(RefSeq) TSC complex subunit 2
  KO
K07207  tuberous sclerosis 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04115  p53 signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04218  Cellular senescence
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    22084 (Tsc2)
   04151 PI3K-Akt signaling pathway
    22084 (Tsc2)
   04152 AMPK signaling pathway
    22084 (Tsc2)
   04150 mTOR signaling pathway
    22084 (Tsc2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    22084 (Tsc2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    22084 (Tsc2)
   04218 Cellular senescence
    22084 (Tsc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    22084 (Tsc2)
   04919 Thyroid hormone signaling pathway
    22084 (Tsc2)
  09149 Aging
   04211 Longevity regulating pathway
    22084 (Tsc2)
  09159 Environmental adaptation
   04714 Thermogenesis
    22084 (Tsc2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    22084 (Tsc2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    22084 (Tsc2)
   05163 Human cytomegalovirus infection
    22084 (Tsc2)
   05165 Human papillomavirus infection
    22084 (Tsc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    22084 (Tsc2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     22084 (Tsc2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Cnd1 Telomere_reg-2
Other DBs
NCBI-GeneID: 22084
NCBI-ProteinID: NP_001034452
MGI: 102548
Ensembl: ENSMUSG00000002496
UniProt: Q7TT21 Q3UGI8
Position
17 A3.3; 17 12.41 cM
AA seq 1742 aa
MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILRELSGECGLNNRIRM
IGQICDVAKTKKLEEHAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQGDRLGVLR
ALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAEFVLQWMDVGLSSEFLLVL
VNLVKFNSCYLDEYIASMVHMICLLCIRTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFI
ITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRSYMEDAPLLRGAVFFVG
MALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRKELQAVTWDI
LLDIIERLLQQLQNLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRPE
SSLLNLISYRAQSIHPAKDGWIQNLQLLMERFFRNECRSAVRIKVLDVLSFVLLINRQFY
EEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLS
PPPELEERDLAMHSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYESLISHIQLHYKH
GYSLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDCMELDRASEKKAS
GPLSPPTGPPSPVPMGPAVRLGYLPYSLLFRVLLQCLKQESDWKVLKLVLSRLPESLRYK
VLIFTSPCSVDQLSSALCSMLSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYL
DKTRQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMA
IPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSRIQTSLTSASLGSA
DENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVG
NKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSSSDPSTHVRQTKEAPAKLESQAGQQVSRG
ARDRVRSMSGGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAKPEKPPAGAQLPTAEKTNL
AAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKE
HRDTALYKSLSVPAAGTAKPPTLPRSNTDSAMVLEEGSPGETQVPVEPPELEDFEAALGT
DRHCQRPDTYSRSSSASSQEEKSHLEELAAGGIPIERAISSEGARPAVDLSFQPSQPLSK
SSSSPELQTLQDILGDLGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGEESRITVPPE
GPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPSFVFL
QLYHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSSSELAILSN
EHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATL
MPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIKGQFNFVHVIITPLDYKCNLLT
LQCRKDMEGLVDTSVAKIVSDRNLSFVARQMALHANMASQVHHSRSNPTDIYPSKWIARL
RHIKRLRQRIREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRKRLISSVDDFTE
FV
NT seq 5229 nt   +upstreamnt  +downstreamnt
atggccaaaccaacaagcaaagattccggcttgaaggagaagttcaagatactgttggga
ttgggaacatcgaggccaaatcccaggtgtgcagaaggcaaacagactgagtttatcatc
acatcggaaatcttgagagaactgagtggtgaatgcggcctcaacaatcgcatccgaatg
atagggcagatctgtgatgtggcaaaaactaagaagcttgaggagcatgcagtggaggca
ctttggaaggctgtctcagacttgctacagccagagcggccaccagaggcccggcatgca
gttctcaccttattgaaggccattgtacagggacagggtgatcgtttgggagttctcaga
gccctcttcttcaaagtgatcaaggactacccctccaatgaagacctccatgaaaggcta
gaagtttttaaggccctcacagacaatgggaggcacattacctatttggaagaagaactg
gcagagtttgtcctgcagtggatggatgttggcttgtcctcagaattccttctggtactt
gtcaacctggtcaagttcaacagctgttaccttgacgaatacattgcatcaatggttcac
atgatttgtctgctatgcatccggacagtgtcctctgtggacattgaggtgtccttgcaa
gtgctggatgctgtggtctgctacaactgcttaccagccgagagcctgcctctgttcatt
atcaccctgtgccgcaccatcaatgtcaaggagctgtgtgagccttgctggaagttgatg
cgtaaccttctgggcacccacctgggccacagcgccatctacaacatgtgccgcatcatg
gaggacagatcctacatggaagatgccccactgctgagaggagctgtgttctttgtaggg
atggcactctggggagctcaccggctctactctctcaagaactcccccacatctgtgctg
ccgtctttttatgaggctatgacctgtcccaatgaggtggtgtcatatgagattgttctg
tccataacaagactcatcaagaagtataggaaggagctccaggctgtgacatgggatatt
ctgctggacatcattgaacgactacttcagcaactccagaacctggacagcccggaactc
aagaccatcgtccatgacctgctgaccactgtggaggagctatgtgaccagaacgagttc
catggctcgcaggaaagatactatgaactggtggagagctatgcagaccagagacctgaa
tcctctctcttaaacttgatatcctacagagcccagtccatccaccctgccaaggatggc
tggatccagaacttgcagttgttgatggagaggttcttcaggaatgagtgccgcagcgcc
gtgcgcatcaaggtgttggatgttctgtccttcgtgctgctgatcaacaggcagttctat
gaggaggagctgattaactcggtggtcatctcgcagctctcccacattcccgaggataag
gaccatcaggtccgaaagctggctactcagctgctggtggacctggcagaggggtgccac
acccaccacttcaacagtctgctggacatcattgaaaaggtgatggcgcgctcactctct
ccacccccggagctggaagaaagggacctggccatgcactcggcctccctggaggacgtg
aagaccgcggtcctggggctcctggtcatccttcagaccaagctctacaccttgcctgcc
agccacgccactcgagtgtatgagagcctcattagtcacatccagctccattacaagcac
ggctactccctgcccattgctagcagcatccgactacaggcctttgacttcctgctgcta
ctgcgggctgactcgctgcatcgactgggcctgcccaacaaggatggggtcgtgagattc
agcccttactgcctctgtgactgcatggaactggatagagcctcagagaagaaagccagt
gggcccctttcacctccaactgggccccctagccctgtgcctatgggccctgctgtgcgg
ctcggctacctaccctactccctgctcttccgtgtcctgttgcagtgtttgaagcaggag
agcgactggaaggtgctgaagctggtgctcagcaggctgccggagtcactgcgctacaaa
gtcctcatcttcacctccccctgcagtgtcgaccagctgtcttctgccctctgctccatg
ctttcagctccaaagacccttgagcggctccgaggtaccccagaaggcttctcgagaact
gacctgcacttggctgtggttcccgtgctaacagcattaatatcttatcacaactatttg
gacaagaccagacagcgtgagatggtgtactgcctggaacaaggccttatctaccgctgc
gccagccagtgcgtggtagccttggccatctgcagtgtggagatgcccgacatcatcatc
aaggcgcttcctgtcctggtggtgaagctcacacacatttctgccacagccagcatggcc
atcccgctcctggagttcctgtctactttggccaggctgccccacctctacaggaacttt
gctgcagagcagtatgccagcgtgtttgccatctccttgccatacaccaacccctccaag
ttcaaccagtacattgtgtgtctggctcaccacgtcatagccatgtggttcatcaggtgc
cgactgccctttcggaaggatttcgtcccttatatcactaagggtttgcgttccaatgtc
ctcctgtcttttgatgatacccctgagaaggacagtttcagagcacggagcaccagtctt
aatgagagacccaaaagcagaatacagacatcccttacgagcgccagcctggggtctgcg
gatgagaactctatggcccaggctgatgacaacttgaagaatctccacttggagctcaca
gaaacatgtctggacatgatggcccgatatgtgttctccaatttcactgcagtccccaag
aggtcccctgtgggagagttcctcctggcagggggtaggaccaaaacctggctggttgga
aacaagcttgtcactgtgacaacaagtgtgggaactggtacacggtcgctgctgggcctg
gactctggggacctgcagggtggctcggattcaagctctgatcctagcacacatgtgagg
cagacaaaggaagcaccggccaaactggagtcccaggctgggcagcaggtgtcccgtggg
gcccgggaccgggtccgctccatgtcagggggccatggccttcgagttggtgtcctggat
acttcagctccctattccccaggtggctctgcttctctgggaccacagacggcggtggca
gcgaagcccgagaagccccctgcaggagcccagcttccaacagcagagaagacgaatctg
gcagcctatgtgcctttgttaacccagggctgggcagaaatcttagtccgcagacccaca
ggaaacaccagctggctgatgagcttggagaacccgctcagccccttctcctcagacatc
aacaacatgcccctgcaagagctgtccaatgcccttatggctgctgaacgtttcaaggag
caccgggacacggccctgtacaagtcattgtcagtgccagcggctggcaccgccaagcct
cctactctcccacgctctaatacagactcagccatggtccttgaggagggaagtccagga
gagactcaggtgccagtggagccccccgaattggaggatttcgaggcggcgttaggtaca
gacaggcactgccagcggcctgacacctacagccggtcatcctcagcatctagccaggaa
gaaaagtcccatttggaggagcttgctgcagggggtatccccattgagcgggccatctcc
tctgagggggctcggcctgccgtggacctctccttccaaccctcacagcctttgagcaag
tctagctcttctccggagttgcagaccttacaggacatccttggagacctaggggacaag
attgatattggacggctgagtcctgaggctaaggtccggtcccagtcagggatcctggat
ggggaagcagctacctggtcagctacgggtgaagagagccgtatcacagtcccacctgaa
ggtcctctgccttccagttctccccgctcccccagtggcctccggccccgaggctatacc
atctctgattccgctccatcacgaaggggaaagagggtagaaagggataacttcaagagc
agagctgcggcctccagtgctgagaaggtgccaggcatcaaccctagctttgtgttccta
cagctctaccattcgcccttttttggtgatgagtccaataagcccatcctattgcccaat
gagtcctttgaacggtcagtacagctgcttgaccagattccatcctatgacactcacaag
attgctgtcctgtatgtgggagaaggccagagcagcagtgagctggccatcctgtcaaat
gagcatggctcttacaggtacacggagtttctgacaggcctgggtcggcttattgagctc
aaggactgccaaccagacaaggtgtacttaggtggactggatgtatgtggcgaggatgga
cagttcacctactgctggcatgatgacatcatgcaagctgttttccacattgccaccctg
atgcccaccaaggatgtggacaagcaccgctgtgacaagaaacggcacctgggcaatgac
tttgtttctatcatctacaatgattctggtgaggacttcaaactgggcaccattaagggc
cagttcaactttgtccatgtgatcatcacaccgctggactacaagtgcaacctattgacc
ctgcagtgcaggaaagacatggaaggcctcgtggacaccagtgtggccaagattgtgtct
gaccgcaacctgtcctttgtggcccgacagatggccctgcatgcaaatatggcctcacag
gtacaccacagccgatccaaccccactgacatctatccctccaagtggatcgcaagactc
cgccacattaagcgtctccgccagaggatccgtgaagaggtgcactattccaacccaagc
ttgcctctgatgcaccctccagcccacaccaaagccccagctcaagcccctgaggctaca
cccacctatgaaacaggccagcggaagcgcctcatttcctccgtggatgacttcacagag
tttgtgtga

DBGET integrated database retrieval system