KEGG   Mus musculus (mouse): 22095Help
Entry
22095             CDS       T01002                                 

Gene name
Tshr, AI481368, hypothroid, hyt, pet
Definition
(RefSeq) thyroid stimulating hormone receptor
  KO
K04249  thyrotropin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04918  Thyroid hormone synthesis
mmu04923  Regulation of lipolysis in adipocytes
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    22095 (Tshr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    22095 (Tshr)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    22095 (Tshr)
   04918 Thyroid hormone synthesis
    22095 (Tshr)
 09160 Human Diseases
  09163 Immune diseases
   05320 Autoimmune thyroid disease
    22095 (Tshr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    22095 (Tshr)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Thyrotropin
    22095 (Tshr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 LRR_8 LRR_5 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 22095
NCBI-ProteinID: NP_035778
MGI: 98849
Ensembl: ENSMUSG00000020963
Vega: OTTMUSG00000049745
UniProt: P47750
Position
12 D3; 12 44.51 cM
AA seq 764 aa AA seqDB search
MRPGSLLLLVLLLALSRSLRGKECASPPCECHQEDDFRVTCKELHRIPSLPPSTQTLKLI
ETHLKTIPSLAFSSLPNISRIYLSIDATLQRLEPHSFYNLSKMTHIEIRNTRSLTYIDPD
ALTELPLLKFLGIFNTGLRIFPDLTKIYSTDIFFILEITDNPYMTSVPENAFQGLCNETL
TLKLYNNGFTSVQGHAFNGTKLDAVYLNKNKYLTAIDNDAFGGVYSGPTLLDVSSTSVTA
LPSKGLEHLKELIAKDTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM
CNESSIRNLRQRKSVNILRGPIYQEYEEDPGDNSVGYKQNSKFQESPSNSHYYVFFEEQE
DEVVGFGQELKNPQEETLQAFESHYDYTVCGDNEDMVCTPKSDEFNPCEDIMGYRFLRIV
VWFVSLLALLGNIFVLLILLTSHYKLTVPRFLMCNLAFADFCMGVYLLLIASVDLYTHSE
YYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHAYT
IMAGGWVSCFLLALLPMVGISSYAKVSICLPMDTDTPLALAYIVLVLLLNVVAFVVVCSC
YVKIYITVRNPQYNPRDKDTKIAKRMAVLIFTDFMCMAPISFYALSALMNKPLITVTNSK
ILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQAYQGQRVCPNNSTGIQ
IQKIPQDTRQSLPNMQDTYELLGNSQLAPKLQGQISEEYKQTAL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgaggccagggtccctgctgctgcttgttctgctgctcgccctgtccaggagcctgcgg
ggcaaagagtgtgcgtctccaccctgtgagtgtcaccaggaggacgacttcagagtcacc
tgcaaggagctccaccgaatccccagcctgccgcccagcacccagactctgaagctcatc
gagactcatctgaagaccatacccagtcttgcattttcgagtctgcccaatatttccagg
atctatttatctatagatgcaactctgcagcggctggaaccacattctttctacaatttg
agtaaaatgactcacatagaaatccggaacaccagaagcttaacctatatagaccctgat
gccttgacagagctccccttgctcaagtttcttggcattttcaatactggacttagaata
ttccctgacttgaccaaaatttattccacggacatattctttatacttgaaatcacagac
aacccttacatgacttcggtccctgaaaacgcattccagggcctatgcaatgaaaccttg
accctgaaactgtacaacaatggatttacttcagtccaaggacatgctttcaatggaaca
aagctggatgctgtttacctaaacaagaataaatacctgacagctatagacaacgatgcc
tttggaggagtatacagtggaccaactttgctagatgtgtcttccaccagcgtcactgcc
cttccttccaaaggcctggagcacctcaaagaactgatcgcaaaagacacctggactctc
aaaaagctcccgctgtcgttgagtttcctccacctcactcgggctgacctctcttacccg
agccactgctgcgcttttaagaaccagaagaaaatcaggggaatcctggagtctttgatg
tgtaatgagagcagtatccggaaccttcgtcaaaggaaatcagtgaacatcttgaggggt
cccatctaccaggaatatgaagaagatccgggtgacaacagtgttgggtacaaacaaaac
tccaagttccaggagagcccaagcaactctcactattacgtcttctttgaagaacaagag
gatgaggtcgttggtttcggccaagagctcaaaaatcctcaggaagagactctccaagcc
ttcgagagccactatgactacacggtgtgtggggacaacgaggacatggtgtgtaccccc
aagtcggacgagtttaacccctgtgaagatatcatgggctacaggttcctgagaatcgtg
gtgtggtttgtcagtctgctggctctcctgggcaatatcttcgtcctgctcattctgcta
accagccactacaaattgaccgtgccgcggttcctcatgtgcaacttggcctttgcagat
ttctgcatgggggtatacctgcttctcattgcctctgtagacctgtacacacactctgag
tactacaaccacgccatcgactggcagacgggccctgggtgcaacacggctggcttcttc
actgttttcgccagtgagttatcagtgtacacactgacggtcatcaccctggagcgatgg
tacgccatcaccttcgccatgcgcctggataggaagatccgcctcaggcacgcgtacacc
atcatggctgggggctgggtttcctgcttccttctcgccctgctcccgatggtgggaatc
agcagctatgccaaggtcagcatctgcctgccaatggacaccgacacccctcttgcactc
gcatacattgtcctcgttctgctgctcaatgttgttgcctttgttgtcgtctgttcctgc
tatgtgaagatctacatcacggtccgaaatccccagtacaaccctcgagataaagacacc
aagattgccaagaggatggctgtgttgatcttcactgacttcatgtgcatggcgcccatc
tccttctatgcgctgtcggcacttatgaacaagcctctaatcactgttactaactccaaa
atcttgttggttctcttctaccccctcaactcctgtgccaatccgtttctctatgctatt
ttcaccaaggccttccagagggacgtgttcatcctgctcagcaagtttggcatctgcaaa
cgccaggcccaggcctatcagggtcagagagtctgtcccaacaatagcactggtattcag
atccaaaagattccccaggacacgaggcagagtctccccaacatgcaagatacctatgaa
ctgcttggaaactcccagctagctccaaaactgcagggacaaatctcagaagagtataag
caaacagccttgtaa

DBGET integrated database retrieval system