KEGG   Mus musculus (mouse): 22099
Entry
22099             CDS       T01002                                 

Symbol
Tsn, 2610034C24Rik, AU040286, C3PO, TB-R, TB-RBP
Name
(RefSeq) translin
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Translin
Other DBs
NCBI-GeneID: 22099
NCBI-ProteinID: NP_035780
MGI: 109263
Ensembl: ENSMUSG00000026374
Vega: OTTMUSG00000049222
UniProt: Q62348 Q545E6
Structure
PDB: 
1KEY

Position
1; 1 E2.3
AA seq 228 aa
MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGTGFQDIPKRCLK
AREHFSTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVT
EILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSG
FRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRGFNKETAAACGEK
NT seq 687 nt   +upstreamnt  +downstreamnt
atgtctgtgagcgagatcttcgtggagctgcagggctttttggctgccgagcaggacatc
cgagaggaaatacgaaaagttgtacagagtttagaacaaactgctcgagagattttgacc
ctacttcaaggggtccaccagggtactggatttcaggacattccaaagaggtgcttgaaa
gcgagagaacatttcagtacagtaaaaacacatctcacgtccctgaagaccaagttcccc
gctgagcagtattacaggtttcatgagcattggcggttcgtgcttcagcgcctggtcttc
ctggcagcatttgtggtatatttggaaacagagaccctggtgacccgagaggctgttaca
gagattcttggcattgaaccagatcgggaaaaagggtttcatctggatgtggaagattat
ctctcaggagttttaattcttgccagtgaactgtcgaggctgtctgtcaacagtgtcact
gctggagactactctcggccccttcacatttctactttcatcaatgagctggattctggt
tttcgtcttctcaatctgaaaaatgactccctgaggaagcgctacgacggcttgaagtac
gatgtgaagaaagtagaggaggtggtctatgacctttccatccgaggcttcaataaggag
acagcagcggcttgtggtgaaaaatag

DBGET integrated database retrieval system