KEGG   Mus musculus (mouse): 22115
Entry
22115             CDS       T01002                                 

Gene name
Tssk2, DGS-G, SPOGA2, Stk22b, Tsk2
Definition
(RefSeq) testis-specific serine kinase 2
  KO
K08811  testis-specific serine kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    22115 (Tssk2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    22115 (Tssk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     22115 (Tssk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  TSSK family
   22115 (Tssk2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    22115 (Tssk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 22115
NCBI-ProteinID: NP_033462
MGI: 1347559
Ensembl: ENSMUSG00000045521
UniProt: O54863
Position
16 A3; 16 11.09 cM
AA seq 358 aa
MDDAAVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPRE
MDILATVNHRSIIKTYEIFETSDGRIYIVMELGVQGDLLEFIKCRGALHEDVARKMFRQL
SSAVKYCHDLDVVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDGSGRIVLSKTFCGSAA
YAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGSMPYDDSDIKKMLRIQKEHRVDFPRSKN
LTGECKDLIYRILQPDVNRRLHIDEILSHSWLQPPKPKAMSSASFKREGEGKYRADCKLD
TRPGSRPEHRPDHKLATKPQQRMLVTPENEDRMEDRLAETSRAKDHHISGAEVEKAST
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggacgatgcggcggtcctaaggaagaagggttacatcgtgggaatcaatctgggcaag
ggctcctacgcaaaagtcaaatctgcctactcagagcgcctcaagttcaatgtggcagtc
aagatcatagaccgcaagaaaacacccactgactttgtggagagattccttcctagggag
atggacatcctggcgaccgtcaaccaccgttccatcattaagacctacgagatctttgag
acctctgatggacgcatctacattgtcatggagctgggcgtccagggcgacctcctcgag
ttcatcaagtgccgaggagccctgcatgaggatgtggcacgcaagatgttccgccagctc
tcctcagccgtcaagtactgccacgacctggatgtcgtccaccgagacctcaaatgtgag
aaccttctgcttgacaaggacttcaacatcaaactgtctgacttcggcttctccaagcgc
tgcctgcgggacgggagtgggcgcatcgtcctcagcaaaaccttctgtgggtcagcagct
tatgcagcccccgaggtgctgcagggcatcccctaccagcccaaggtgtatgacatctgg
agcctgggtgtgattctctacatcatggtctgtggctccatgccctacgatgactctgac
atcaaaaagatgctgcgcatccagaaggagcaccgagtggacttcccacgctccaagaac
ctaactggtgagtgcaaggacctcatctaccgcatcctacagccagatgtcaaccggcgg
ctgcacattgatgagatccttagccactcatggctacagccccccaagcccaaagccatg
tcttctgcctccttcaagagggagggggaaggcaagtatcgagctgattgcaagttggat
actcgaccaggctccagacccgaacaccggcctgaccacaagctggcgaccaaaccccag
caacggatgctggtgacacccgagaatgaagacaggatggaagacaggctggctgagact
tccagagctaaagaccatcacatttctggagctgaggtggagaaagcaagtacctag

DBGET integrated database retrieval system