KEGG   Mus musculus (mouse): 22117
Entry
22117             CDS       T01002                                 

Symbol
Tst, Rhod, rhodanese
Name
(RefSeq) thiosulfate sulfurtransferase, mitochondrial
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu00920  Sulfur metabolism
mmu01100  Metabolic pathways
mmu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    22117 (Tst)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    22117 (Tst)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    22117 (Tst)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     22117 (Tst)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     22117 (Tst)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 22117
NCBI-ProteinID: NP_033463
MGI: 98852
Ensembl: ENSMUSG00000044986
UniProt: P52196 Q545S0
Position
15 E1; 15 37.47 cM
AA seq 297 aa
MVHQVLYRALVSTKWLAESIRSGRLGPSLRVLDASWYSPGTRQARKEYQERHVPGASFFD
IEECRDTTSPYEMMLPSEAHFGDYVGNLGISNDTHVVVYDGDDLGSFYAPRVWWMFRVFG
HRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATLNLSLLKTYEQVLENLQSKRFQLV
DSRAQGRYLGTQPEPDIVGLDSGHIRGSVNMPFMDFLTKDGFEKSPEELRAIFQDKKVDL
SQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPETRVSQGKSGKA
NT seq 894 nt   +upstreamnt  +downstreamnt
atggtacatcaggtgctctaccgggcgctggtatccaccaagtggctggcggaatccatt
cggtctggccgcctggggcccagccttcgggtgctggacgcgtcttggtactcacccggg
acccgccaggcacgcaaagagtaccaggagcgacacgtgcctggcgcgtccttctttgat
atagaggaatgccgggacacgacttcgccttatgagatgatgctgcccagtgaggcccac
tttggggactatgtgggcaacctgggcataagcaacgacacacatgtggtggtatacgat
ggagatgacctgggcagcttctatgcacccagagtctggtggatgtttcgtgtgtttggc
caccgcacagtgtcagtgctcaatggtggcttccggaactggctgaaggagggccacccg
gtgacatctgagccctcgaggccagagccagccgttttcaaagccacactgaatctctcc
ctgctcaagacctatgagcaggtcctagagaatctccagtctaaaaggttccagctggtg
gactctcgggcccaaggacggtacctgggcacacaaccggagccggatatagtaggacta
gactcgggccacatccgtggctcagtcaacatgcccttcatggacttcctgacgaaagat
ggcttcgagaagagcccagaggagctgcgtgccatattccaggacaagaaggtggacctc
tcacagcccctcattgccacgtgccgcaagggggtcactgcctgtcacgttgccctggct
gcctacctttgtggcaaacccgatgtggctgtttacgatggctcctggtcagagtggttc
cgcagggcacccccagagacccgtgtgtcccaggggaagagtgggaaggcctga

DBGET integrated database retrieval system