KEGG   Mus musculus (house mouse): 22138
Entry
22138             CDS       T01002                                 
Symbol
Ttn, 1100001C23Rik, 2310036G12Rik, 2310057K23Rik, 2310074I15Rik, AF006999, AV006427, D330041I19Rik, D830007G01Rik, L56, mdm, shru
Name
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    22138 (Ttn)
   05414 Dilated cardiomyopathy
    22138 (Ttn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    22138 (Ttn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    22138 (Ttn)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22138 (Ttn)
   04147 Exosome [BR:mmu04147]
    22138 (Ttn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     22138 (Ttn)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   22138 (Ttn)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    22138 (Ttn)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     22138 (Ttn)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22138 (Ttn)
SSDB
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Pkinase C1-set Ig_6 Titin_Z PK_Tyr_Ser-Thr Ig_4 Adeno_E3_CR1 NDNF PPAK THB
Other DBs
NCBI-GeneID: 22138
NCBI-ProteinID: NP_001372637
MGI: 98864
Ensembl: ENSMUSG00000051747
Position
2:complement(76534324..76812901)
AA seq 35463 aa
MTTQAPMFTQPLQSVVVLEGSTATFEAHVSGSPVPEVSWFRDGQVISTSTLPGVQISFSD
GRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFSQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELVVQGEEVVPAKKTKTIVSTAQISETRQTRIEKKIEAHFDARSIATVEMV
IDGATGQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPTP
SPVRSVSPAGRISTSPIRSVKSPLLIRKTQTTTMATGPEVPPPWKQEGYVASSTEAEMRE
TTMTSSTQIRREERWEGRYGVQEQVTISGAAAAAASASVSSSFTAGAITTGTKEVKQETD
KSAAVATVVAAVDMARVREPAISAVEQTAQRTTTTAVHIQPAQEQARKEAEKTAVTKVVV
AADKAKEQELKSRTREVMVTTQEQTHISHEQIRKETEKAFVPKVVISATKAKEQETRITG
EITTKQEQKRITQETIRQETEEIAASMVVVATAKSTKLEAAVGVQEETAIQQDQMHLTHE
QMMKETRKTVVPKVIVATPKIKEQDLVSRSREAITTKRDQVQITQEKKRKEVETTALSTI
AVATAKAKEQETVLRSREAMATRQEHIQVTHGQVGVGKKAEAVATVVAAVDQARVREPRE
PTHVEESHSQQTTLEYGYKEHISTTKVPEQPRRPASEPHVVPQAVKPAVIQAPSETHIKT
TDQMGMHISSQVKKTTDISTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAI
ATLQKELSATSSTQKITKSVKAPTVKPGETRVRAEPTPSPQFPFADMPPPDTYKSQAGIE
VKKEVGVSISGSTVREEHFEVLRGREAKVTETARVPAPAEVPVTPPTLVSGLKNVTVIEG
ESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSA
VNEAGTVSTSCYLAVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGE
PAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGE
CRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYEALVKTQQEMLYQTQMSTFIQ
EPKVGEIAPGFAYSEYEKEYEKEQALIRKKMAKDTVMVRTFVEDQEFHISSFEERLIKEI
EYRIIKTTLEELLEEDGEEKMAVDISESEAIESGFDIRIKNYRILEGMGVTFHCKMSGYP
LPKIAWYKDGKRIRHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGK
LYVEPAAPFSAPTYMPTPEAVSRIRSVSPRSLSRSPIRMSPAMSPARMSPARMSPARMSP
ARMSPGRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHNG
QQIVNDYTHKVVIKEDGTQSLIIVPASPSDSGEWTVVAQNRAGKSTISVTLTVEAVEHQI
KPAFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAA
LKIDSIISQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAA
PELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTM
VVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIV
KDEKSLVEESQLPDGKKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLE
GETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTA
ENPEGVTEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPVDTSETK
EVVKLKRAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLKKT
KDELLHWTKELTEEEKKALAEEGKITIPTFKPERIELSPSMEAPKIFERIQSQTVGQGSD
AHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAI
NIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFIKVKWYKDGIEV
HAGDKYRMHSDRKVHFLSVLTIDTSDAEDYSCVLVEDENIKTTAKLIVEGAVVEFVKELQ
DIEVPESYSGELECIISPENIEGKWYHNDVELKSNGKYSITSRRGRQNLTVKDVTKEDQG
EYSFVVDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQE
VQHSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGNVSVYSVDVITPLKDV
NVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQSIVKGTKQRLVINRTHASDEGP
YKLMVGRVETSCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVVWNFKGKEIKP
SSKYKIEAHGKIYKLTVLNMMKDDEGEYAFYAGENTTSGKLTVAGGAISTPLTDQTVAES
QEAVFECEVANPESEGEWLKDGKHLALSNNFRGESDGHKRRLVIAAAKLDDAGEYTYKVA
TSKTSAKLKVEAVKIKKTLRNLTVTETQDAVFSVELTHPDVKGVQWIKNGVVLDSNDKYE
ISVKGTLYSLKIKNCAMADESVYGFKLGRLGASARLHVETVKIIKKPKDVTALENATVTF
EVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQSISPSDAGEYTAMVGQLECK
AKLFVETLHITKTMKSIEVPETKAASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGK
LHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNY
EGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVE
ARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDGQELQIADRIKIQKEKYVHRL
LIPSTRMSDAGKYTVVAGGNMSTANLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDD
VDAHWYKDGIEINFQVQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVN
APEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEY
TLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIVTPLQDT
VTSEGRPARFQCQVSGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTY
AFVANNAVGQVSSTATLRLEGFSKSEEVTSKSQWHTSPSVSLKKEALGQKPIFIQPLSSL
RVHSGETVRFHARVSGVPKPAIQWFHNHQPILPSKDVVFHFEESTGMALMLIVDAYPEHA
GKYSCRAANSAGEATCAATLTVTAKAPESILHERIGQQIEMEMKEIASLLSAEEDFQTYS
SDLRLPNANETLELLSEPPARSTQFDSRQEGAAPVFIREISDVEISVEDVAKLSVTVTGC
PKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEGEYTCLASNEYGKAVCSAH
LRISPRGERSTEMESGEKKALEKPKGPCPPYFFKELKPVHCGPGIPAVFEYSVHGEPAPT
VLWFKEDMPLYTSVCYTIIHSPDGSGTFIVNDPQRGDSGLYLCKAQNLWGESTCAAELLV
LPEDTDVPDASCKEESTLGVPGDFLETSARGPLVQGVDSRQEITAFAEGTISKAALIAEE
TLQLSYERSVDDSEVGTGVTIGAQKLPPVVLSTPQGTGELPSIDGAVHTQPGRGPPPTLN
LQAVQAQTTLPKEATLQFEEPEGVFPGASSAAQVSPVTIKPLITLTAEPKGNYPQSSTAA
PDHALLSSVAAETLQLGEKKIPEVDKAQRALLLSQSLAEGCVESLEVPDVAVSNMRSEPQ
VPFQHTCTEGKILMASADTLKSTGQDVALRTEEGKSLSFPLALEEKQVLLKEEQSEVVAV
PTSQTSKSEKEPEAIKGVKEVREQELLSKETLFPSMPEEQRLHLKTQVRRALQAAVAREQ
ANLFSEWLRNIDKVEVTAVNFTQEPKRILCTYLITSVSSLTEELTVTIEDIDPQMANLET
GLKDALCSIVCEERNILMAEDPRIHEEDKIDVQGGRDHLSDAQKVETVIEAEADSKYLVS
KEEVSWSKVESQLKDGDTNEVPQAETLKLAEESGTQKTSTEMSQEEAEGTLADLCPAVLK
HLVDTISEEGDTVHLTSSISNAKEVHWYFKGNLVPSDGKFKCLKEQNAYTLVIEAVKTED
EGEYVCEASNDSGKAKTSAKLTVGERAAPVIKRRIEPLEVALGHLAKFTCEIQGAPNVRF
QWFKAGREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTE
AYPPTFLSRPKALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPSPDCRVTDADNKHS
LELSNLTVQDRGIYSCKASNKFGADICQAELTIIDKPHFIKELEAVQSAINKKIHLECQV
DEDRKVTITWSKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYTCTASNEAGSSSS
SAAVAVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMS
FVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKEPPSFIKTLEPADIVRGAN
ALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVAN
EVGKCGCVATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISVMWMKGQEVIKED
GKIKMSFSNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQ
VTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISFKNNIAQLKFYSAELHDSGQY
TFEISNEVGSSSCETTFTVLDRDIAPLFTKPLRNVDSVVGGACRLDCKIAGSLPMRVSWF
KDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPS
FVTKPGSRDVLPGSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYA
VKTSDSGTYTCKVSNVAGSVECSADLFVKEPATFIEKLEPSQLLKKGDGTQLACKVTGTP
PIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIV
IVKESPYFTKEFKSIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFLQDQL
VSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLREPPSFIKKIEATSSLRGGTAAFQA
TLKGSLPITVTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQ
RCSALLSVKEPATIMEEAVSIDVTQGDPATLQVKFSGTKEISAKWFKDGQELTLGPKYKI
SVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKASINVLDLIIPPSFTKKLRKMDSI
KGSFIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTC
SATNKAGHSQCSGHLTVKEPPYFVEKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKE
LHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIFVKEPPQFIKKP
SPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFVDGLATFQISNARVE
NSGTYVCEARNDAGTASCSIELKVKEPPIFIRELEPVEVVKDSDVELECEVMGTTPFEVT
WLKNNKEIRSGKKYTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSCACSARVALKEP
PSFIKKIENVTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVATLQV
RSVDNGHSGRYTCQAKNESGIERCYAFLLVQEPAQIIEKAKSVDVTEKDPVTLECVVAGT
PELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAY
LRVLDQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVC
HENTVSLEVSNLELEDTANYTCKVSNVAGDNACSGILTVKEPPSFLVKPERQQAIPDSTV
EFKAVLKGTPPFKIKWLKDDVELVSGPKCFIGLEGSTSFLNLYSVDSSKTGQYTCQVTND
VGSDSCTTMLLVTEPPKFVKKLEASKIIKAGDSARLECKITGSPEIQVVWYRNEHELTAS
DKYQMTFIDSVAVIQMNSLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVE
TLKNTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEY
HCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEK
EEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVII
EKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVE
KEDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPPSFTRRLKDTGGVLGTSCILECKVAGSS
PISIAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECRALL
TVQEPPSFVKEPEPLEVLPGKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNIYFEDTV
AELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPATFVKKLSDHSVEPGKSIILEG
TYTGTLPISVTWKKDGVSITPSERCNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRD
ACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRT
YFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFARQLKDIEQT
VGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSC
SASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKD
NKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFI
KKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEA
SAEDTGDYICEAHNGVGDASCSTALKVKAPPVFTQKPPPVGALKGSDVILQCEISGTPPF
EVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKF
KEPPRFVKKLSDASTLIGDPVELQAVVEGFQPISVVWLKDKGEVIRESENVRISFVDNIA
TLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLEPATIVEKPEPMTVTTGNPFTLECV
VAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSS
CTVSVHVSDRVVPPSFVRRLKDTSATLGASVVLECRVSGSAPISVGWFLDGNEIISSPKC
QSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTVQEPPSFEQTPDSVEVLP
GMSLTFTSVIRGTPPFKVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCL
VTNDAGSASCTTHLFVKEPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYPL
SQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLE
HVEAAIGEPITLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDV
GEYTCKAENSVGAVASSAVLVIKERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQV
SWYKDGELLKDDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSE
HEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTA
TLTVLKVAKGDAGQYTCYASNVAGKDSCSAQLGVQEPPRFIKKLDQSRIVKQDEYTRYEC
KIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSA
SSSTSLKVKEPPVFRKKPFPVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKI
MSENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIGK
EVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTCQI
KNDAGMQECYATLSVLEPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELT
SDNKYKISFFNKVSGLKIINVVPGDSGVYSFEVQNPVGKDSCKVSIQVSDRIIPPSFTRK
LKETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEA
DAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVS
WFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAGRASCTTRLFVKAP
AIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEI
LSSTVEDSGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVTVGDSASLQCQLAGT
PEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGEVSSSTF
LTVQEQKLPPSFSRQLRDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSF
LDNIATLNIFKTDRSLSGQYSCTATNPIGSASSGAKLILTEGKNPPFFDIPLAPMDAVVG
ESADLECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYA
VNEVGKDSCTAQLNIKERLIPPSFTKKLSETVEETEGNSFKLEGRVAGSQPITVAWYKNN
VEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAGSALCTSSIVIKEPKKPPV
FDQHLAPVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKE
TAKADSGDYVCKASNVAGSDTSKCKVTIKEKPAAAPAAKKAAVDGKLFFVSEPQSIRVVE
KTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRC
VAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPALKKGSGEEEEIDIMELLKNVD
PKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEELEKSERDEKEFEELVAFIQ
QRLTQTEPVTLIKDIENQTVLKDNDAIFEIDIKINYPEIKLSWYKGTEKLEPSNKYEISI
DGDRHTLRVKNCQPKDQGNYRLVCGPHIASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQ
FSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAEL
RIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRC
HYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIKLEMKPPDIPDSRVPIPTM
PIRAVPPEEIPPAVAPSIPLLLPLPEEKKPPAKRIEVTKKGVKKDTKKVVTKPKEEAPPP
PVPEVAKKPPPPTPMIPAKASEIIDVSSKAEEVKITTITRKKEVHKEKEAVYEREEAVYE
KKVHIEPWEEPYEELETEPYTEPYEEPYYEEPDEDYEEIKVEAKKQVHEEWEEDFEEGQE
YYEREEGYDEGEEEWEEIYHEREIIQVQKEVHEELHEKKIPAKVPEKKVPPPKVVKKPVV
EKVEKTTRRMEEEKVQVIKVPEVSKKIVPQKPSRTPVQEEIIEVKVPAVHTKKMVISEEK
MFFASHTEEEVSVSVPEVQKKTVTEEKIHVAVSKKIEPPPKVPEPPKKPVPEEVVPVPIP
KKVEPPAAKVPEAPKKPVPEEKKPVPIPKKKEPAAPPQVPEAPKKPAPEEKIPVPVTKKK
EAPPAKVPEVQKKVVTEEKIAIITQREESPPPAVPEIPKKKVPEEKRPVPRKEEVPPPKV
PVPPKKAVPEAVVPAPIPKKAPPRAEVSKKTVVEEKRFAAEEKLSVAVPQRVELMRHEEE
EWTYSEEEERVSVSVYREEERDEEEAEITEYEVLEEPEEYVVEEKMHFISKKVEVEPAKV
PEKKIIPKPKVPAKIEEPPPTKVPEPPKKIVPEKKVPAPAPKKVPPAKAPEESKRPVPEK
RAPAEEVGIEEPPPTKVAERHMKITQEEKVLVAVTKKEAPPRARVPEEPKKVAPEERFPK
LKPRREEEPPAKVTEVRKRAVKEEKVSIEVPKREPRPTKEVTVTEEKKWSYTREEETVSE
HREEEYEDYEDYEEYKEFEEYEPTEEYDQYDEYAEREVEHYEEHEEYVTEPKKPVPVKPA
QEPVPAKPKAPPPKVLKKAVPEEKAPLPIQKKLKPLPPKAPEEPKKVVEEKIQISITKRE
KQQVTEPVAKVPMKPKRVVPEAKIPAPTKEVAVPVRVPGVPKKRELEEVVVFKEEVEAHE
EYIVEEEEEYVHEEEYVHKEEYVHEEEYVHKEEYIHEEEEHLHEEEETIAEEEVVPVAPV
KVPVVPKKPVPEEKKPVPVPKKKEAPPAKVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVP
KKPVPEEKPPVPVPKKVEPPPAKVPEVPKKPVPEKKVPAPTPKKVEAPPAKVPEVPKKPI
PEEKKPTALLKKMEAPPPKAPKKREVVPVPVALPREEEEEEVPFEEVPEEEILPEEEVPS
EEEAPPEEVPPEEEEVLPEEEEVLPEEEEVLPEEEEVQPEEEALPEIKPKVPKPAPVPKK
TVPEKKVPVPVPKKVEPPPPPKVPEIKKKVPEKKVVVPKKEEAPPTKVPVVPKKPEPEKK
VPVPALKKAVVPPAKVPEVSKKVEERRIIPPKEEEVPPAEVYEEAEEPTPEEIPEEPPSI
EEEEIVEEEEEEEEVLPPRAPEVVKKAVPEAPTPVPKKAEAPPAKVPKKIPEEKVPVPVQ
KKEAPPAKVPEVPKKVPEKKKIPEKKVPVPKKEAVPPAKGKAVFEEKISVAYQQEELVQE
RIELELVEAKVEEAFEEEEFHEVQEYFEEEEFHEVEEFIRVEERRFQEEHKVEEVHRVIE
FLEAEEVEVYEKPKIPPKKGPEVSEKVIPPKKPPTKVIPRKEPPAKVPEVTKKTVVEEKI
RAPEEPKVPAPKAPEVPKKITPEEKVREAVPKKPEVPPPKVPEVPKKIIQEEKLPVVLPE
DTEIYMYEASEETVIEEEHVTLPQKARLKVAKVPAPPQTVVTEEKTYVTIRKTRETLALK
ESETTREAFPELKSYKAVPEIPEPPSPEDLEIIEDVLPEKRPPASKRRKTQLPTAPEAPR
EMPPEMNTFEEISVEPEMLPTQEPEAPTEVDVAKRAPSKPRGAPAVTVLDTYQEATVEKK
TLRISRKKPELPSDEEVPEAPREVVAKKKVLPPQVPEVVPVKVPGAPKEVVSERKSLEEP
PKKPAVRPVTVPEEPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEP
EAPPAKVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAPP
VKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKTAVPQKKIPEAIPPKPESPPLEVP
EVPPKEVTPEKKVPAAPPTKPEIPPPKVPEAPQAAVVEEKTPEALPKKAEAAPVPVPQVQ
ETVPEKTRPVGPPKKPEATTVPVPKVQKTIPEKTRPEAPPKRPEARTVPVPQVQETVPEK
TRPMAPPKKPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIPEKTRPPKK
PEATPVPVPEVQETVPEKTRPVGPPKKPEATTVSVPEVQETIPEKTRPAAPPKKPEATAV
PVPKVQETIPEKTRPEAPPKRPEATTVPVPEADQAVVPEKKVPRVPPKKVEAPPITVPEE
PKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEAPPAKVPEAPKEV
VPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAPPVKVPEAPKKVVPEK
KLPVAAPKKPEAPAAEVPEVPKAAVPQKKIPEAIPPKPESPPPEVYEEPEEEIVPEEPPE
EAVEEPVPAPPPKVTEPPKKPVPEKKAPPAVVKKPEPPPAKVPEVPKEAPPEKKVPPKKP
EAPPAKVPEVPKEVVTEKKVAVPKKPEVPPAKVPEVPKKPVIEEKPAIPVVEKVASPPAE
VYEEPEEVTAEEEEPAPAVEEEEYEAPPPPAPVPEEPKKVVPEKKFPVIKKPEAPPPKVP
EVPKKAVPVKKVPVVKKPEPPEAEVPEVPKKLVPVKKEPVPVTKKTEVLPEKVPEAPKKI
TPEKKESVPVPEEPEAPPASVEETPEETIYEEKATITIGRKETPPVEEREIEKFIQPEEP
ELEPEPEEIPVQEPEPEKKVIEKPKLKPRPPARPPSPPKEDVKEKMFQLKAVSKKKVPEK
PEVVEKVEPAPLKVPTAEKKVRKLLPEPKPQPKEEVVLKSVLRKKPEEEEPKVEPKKVEK
AKKPEEPQPPPKAVEVEAPPEPTPKERKVPEPAKVPEIKPAIPLPGPEPKPKPEPEVKTM
KAPPIEPAPTPIAAPVTAPVVGKKAEAKPKDEAAKPKGPIKGVAKKTPSPIEAERKKLRP
GSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSPSTAITTWMK
DGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLIVEELPVR
FVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTIND
ADDTDAGTYTVTVENANNLECSSCVKVVEIIREWLVKPIRDQHVKPKGTAVFTCDIAKDT
PNIKWFKGYDEIPLEPNDKTEILKEGNHLFLKVKNAMPEDIDEYAVEIEGKRYPAKLTLG
EREVELLKPIEDVTIYEKESASFDAEISEEDIPGEWKLKGELLRPSPTCEIKAEGGKRFL
TLHKVKLDQAGEVLYQACNAITTAILTVKEIELDFAVPLKDVTVPEKRQARFECVLTREA
NVIWSKGPDIIKASDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSAQLFVTGIR
LKFISPLEDQTVKEGQTATFVCELSHEKMHVVWFKNDVKLHTTRTVLMSSEGKTYKLEIR
ETTLDDISQIKAQVKNLSSTANLKVLEADPYFTVKLHDKTGVEKDEIILKCEVSKDVPVK
WFKDGEEIVPSPKHSVKTDGLRRILKIKKAELKDKGEYVCDCGTDTTKANVTVEARLIKV
EKPLYGVEVFVGETARFEIELSEPDVHGQWKLKGEPLTASPDCEIIEDGKKHVLVLYNCQ
LDMTGEISFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWL
KGTQEITGDDRFELIKDGTRHSLVIKSAAFEDEAKYMFEAEDKRTSGKLIIEGIRLKFLT
PLKDVTAKERENAVFTVELSHDNIPVSWFKNDQRLHTSKRVSMHDEGKTHSITFKDLSID
DTSQIRVEAMGISSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKD
GKEIKPSKNVVIKADGKKRMLILKKALKSDIGQYTCDCGTDQTSGKLDIEDREIKLVRPL
YSVEVMETETARFETEISEDDIHANWKLKGEALLQTPECEIKEEGKIHVLILHNCRLDQT
GGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGK
KLEPNDKVVTRSEGRVHTLTLRDVKLEDAGEVQLTAKDFKTQANLFVKEPPVEFTKPLED
QTVEEEATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKT
YTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVKEKETARFECEISKENEKVQWFKDGAEI
KKGKKYDIISKGAVRILVINKCLLNDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANLE
VSEGDTIKLVCEVSKPGAEVIWYKGDEEIIETGRFEILTDGRKRILIIQNAQLEDAGSYN
CRLPSSRTDSKVKVHELAAEFISKPQNLEILEGEKAEFVCTISKESFEVQWKRDDQTLES
GDKYDIIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIIVPLKDTKVKE
QQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDARLDDQANFNVSL
TNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEV
AFDNRISYRIDKYKHSLIIKDCGFPDEGEYVVTAGQDKSVAELLIIEAPTEFVEHLEDQT
VTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLEDECEYA
CGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVIFLAELNKDKVEVQWLRNNMIVVQ
GDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDA
GQPLTMVVPYDAYPKAEAEWFKENEPLSTKTVDTTAEQTSFRISEAKKDDKGRYKIVLQN
KHGKAEGFINLQVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKR
KTWVLVTDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSPVEARSKYDVPGP
PLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVT
DVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLNASEQTQSSVQLTWE
PPLKDGGSPILGYIIERREEGKDNWIRCNMKPVPELTYKVTGLQKGNKYLYRVSAENAAG
VSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPKATWTFGDQ
VLEEGDRVKMKTISAYAELVISPSERTDKGIYTLTLENPVKSISGEINVNVIAPPSAPKE
LKFSDITKDSVHLTWEPPDDDGGSPLTGYVVEKRDMSRKTWTKVMDFVTDLEFTVPDLVQ
GKEYLFKVCARNKCGPGEPAYTDEPVNMSAPATVPDPPENVKWRDRTANSIFLTWDPPKN
DGGSRIKGYIVEKCPRGSDKWVACGEPVPDTKMEVTGLEEGKWYAYRVKALNRQGASKPS
KPTEEIQAVDTQEAPEIFLDVKLLAGITVKAGTKIELPATVTGKPEPKITWTKADTLLKP
DQRITIENVPKKSTVTITDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDIT
DVTNESCLLTWNPPRDDGGSKITNYVVERKATDSDVWHKLSSTVKDTNFKATKLTPNKEY
IFRVAAENMYGVGEPVQAAPIIAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSP
ITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTE
PILIKDPIDPPWPPGKPTVKDIGKTSLVLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRV
AEGVPTTEHLLTGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVI
NITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLY
VFRVAAENAIGQSDYTEIGDSVLAKDTFTTPGPPYALTVVDVTKRHVDLKWEPPKNDGGR
PIQRYIIEKKEKLGTRWVKAGKTSGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPT
EILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMR
VNSRPIKDLKFKVEEGIVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCKPTIDLET
HDIVVIEGEKLNIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVHAD
AGVYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGSPILH
YVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIA
QDPKQPPDPPVDVEVHNPTAKAMTITWKPPLYDGGSKIMGYIIEKITKGEDRWKRCNEHL
VPVLTYTAKGLEEGKEYQFRVRAENAAGIGEPSRATPPTKAVDPIDAPKVILRTSLEVKR
GDEIALDATISGSPYPTITWIKDENVIVPEEIKKRAAPPVRRKKGEAEEEEPFSLPLTER
LSINNSKQGESQLRIRDSLRPDHGQYMIKVENDHGVAKAPCSVSVLDTPGPPINFVFEDI
RKDSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSDWIVITSTLRNCKYSVTKLIEGKEY
LFRVRAENRFGPGPPCVSKPLLAKDPFEPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPI
LGYWLEKREVNSTHWSRVNKTLLSSLKTKVDGLLEGLTYVFRVCAENAAGPGKFSPPSDP
KTARDPISPPGPPVPRVADTSSTTIELEWEPPAFNGGGEIMGYFVDKQLVGTNEWSRCTE
KMIKVRQFTVKEIREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQEPPTVELDVSVKGG
IQIMAGKTLRIPAEVTGRPVPTKVWTIEEGELDKERVIIENVGTKSELIIKNALRKDHGR
YVITATNSCGSKFAAVRVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSDITGFII
ERKDAKMHTWRQPIETERSKCDITGLIEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLG
PPTSPERLTYTERTKSTITLDWKEPRSDGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTS
FLVENLDEHQMYEFRVKAVNDVGESEPSLPLNVVIQDDEVPPTIKLRLAVRGDTIKVKAG
EPVNIPADVTGLPMPKIEWSKNEKVIDKPTDTLNITKEEVSRSEAKTELSIPKAAREDKG
TYTITASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYI
IDKRDASRKKSEWEEVTNTAVERRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQ
DPYRLPGPPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGTYWSRVSRAPI
TKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPSEPSDPAVAGDPIYPPGPPSCPEV
KDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGTTDWKPVNEPDKLLTACECVVPNLKE
LRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEVPEVFIDIGAQDCLVCKAGSQVKIPAV
IKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECTRAHSGKYSITA
KNKAGQKTANCRVKVMDAPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKKTI
DGKAWTKVNPNCGSTTFVVPDLISEQQYFFRVRAENRFGIGPPAETIQRTTARDPIYPPD
PPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWRQCNRRDVEE
LEFTVEDLIEGGEYEFRVKAVNEAGVSKPSATVGPVIVKDQTCPPAIELKEFMEVEEGTD
VNIVAKIKGVPFPTLTWFKAPPKKPDSKEPVVYDTHVNKQVVDDTCTLVIPQSRRSDTGL
YSITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYV
IEKREANRKTWVRVSSEPKECMYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNL
FSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKA
MTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTARDPVAPPGPPFPKVTDWT
KSSVDLEWSPPLKDGGSKITGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKF
RVRAVNVAGVGEPGEVTDVIEMKDRIVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPP
PTVTWSMNERALPQEAAIETTAISSSMVIKNCQRSHQGVYSLLAKNEGGERKKTIIVDVL
DVPGPVGIPFLSDNLTNDSCKLTWFSPEDDGGSPITNYVIQKREADRRAWTPVTYTVTRQ
NATVQGLIQGKSYFFRIAAENSIGMGPFVETPNALVIRDPITVPERPEDLEVKEVTKNTV
SLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSA
VNIVGQGKPSFCTKPITCKDELAPPTLDLDFRDKLTVRVGESFALTGRYSGKPKPKIDWF
KDEADVLEDDRTHIKTTPTTLALEKTKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPG
PPVGPVIFDEVTKEYMVISWKPPLDDGGSEITNYIIEKKELGKDIWMPVTSASAKTTCKV
PKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFRVPDAPEQPVVTEVTKDSALVTWN
KPNDGGKPITNYILEKRETMSKRWVRVTKEPIHPYTKYRVPDLLEGCQYEFRVSAENEIG
IGDPSPPSKPVFARDPIAKPSPPINPEAIDTTCNSVELTWQPPRHDGGSKILGYIVEYQK
VGDEEWRRANHTPESCPETKYKVTGLRDGQSYKFRVLAVNEAGESDPAHVPEPVLVKDRL
EPPELILDANMAREQHIRVGDTLRLSAIIKGVPFPKVTWKKEDREAPTKAQIDVTPVGSK
LEIRNAAHEDGGIYSLTVENPAGTKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEP
LDDGGSVVTNYVVERKDVATAQWSPLSTTSKKKSHMAKHLTEGNQYLFRVAAENQYGRGP
FVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGD
KDWIKFKTVKNLDCVVTGLQQGKTYRFRVKAENIIGLGLPDTTIPIECQEKLVPPSVELD
VKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGTEIKTDDHYTVETDSFSSVLTIKNC
LRKDTGEYQLTVSNAAGTKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGG
SPVINYIVEKQDTRKGTWGVVSAGSSKLKLKVPHLQKGCEYVFRVKAENKMGVGPPLDSI
PTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVN
KTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLK
DKSKESADLVWTKPLSDGGSPILGYVVEYQKPGTAQWDRINKDELIRQCAFRVPGLIEGN
EYRFRIRAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVK
GRPEPDITWSKEGKVLVKDKRVDLIHDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGS
AIVNVLDRPGPCQNLKVSNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVAS
DVTKRLVKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKG
KTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWERVHKGSIKETHYMVDKCVENQIYEF
RVQTKNEGGESDWVRTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEV
AWTKDKDATDLTRSPRVKIDTSAESSKFSLTKAKRSDGGKYVITATNPAGSFVAYATVNV
LDKPGPVRNLKITDVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSANVLTP
SATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDPPEVTKVSKEEMT
VVWNAPEYDGGKSITGYYLEKKEKHAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAE
NEVGIGEPSLPSRPVVAKDPIEPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVV
EMRPKIADASPDEGWKRCNAAAQLIRMEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKE
AIKPKEILEPPEIDLDASMRKLVVVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQ
VDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVKVLDTPGPVADLKVSDVTKT
SCHVSWAPPENDGGSQVTHYIVEKREAERKTWSTVTPEVKKTSFNVTNLVPGNEYFFRVT
AVNEYGPGVPTDIPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGY
IISYREEDQPADRWTEYSVVKDLSLIVTGLKEGKKYKFRVAARNAVGVSMPREAEGVYEA
KEQLLPPKILMPEQITIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAIHKADGS
SVLIIKDVTRKDSGYYSLTAENSSGSDTQKIKVTVMDAPGPPQPPFDISEIDADACSLSW
HIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFG
ISEPLTSPKMLAKFPFDVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKER
NSLLWVKANDTIVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPP
GKPEVVDVTKNSASLIWARPKHDGGSRIIGYFVEACKLPGDKWVRCNTTPHQIPQEEYTA
TGLEENAQYQFRAIAKTAVNISQPSEPSDPVTILAENVPPRIELSVEMKSLLTVKAGTNV
CLDATVFGKPMPTVSWKKDTTPIKQAEGIKMAMKRNLCTLELFSVNRKDSGDYTITAENS
SGSKSATIKLKVLDKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIIDKRETSRP
NWAQVSATVPITSCTVEKLIEGHEYQFRICAENKYGVGDPILTEPAIAKNPYDPPGRCDP
PVISNITKDHMTVSWKAPADDGGSPITGYLVEKRETQAVNWTKVNRKPVIERTLKATGLQ
EGTEYEFRVTAINKAGPGKPSDASKAVYAQDPLYPPGPPAFPKVYDTTRSSVSLSWGKPA
YDGGSPIIGYLVEVKRADSDHWVRCNLPEKLQKTRFEVTGLMENTEYQFRVYAVNKIGYS
DPSDVPDKHCPKDILIPPEGELDAELRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVN
LRERIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNV
TVKEVSKDSAYVTWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEG
KSYFFRVFAENEYGIGDPGETRDAVKASETPGPVVDLKALAITKSSCTIGWKKPRSDGGS
RITGYVVDFLTEENKWQRVMKSLSLQYSTKDLKEGKEYTFRVSAENENGEGTPSEIVVVA
KDDVVAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVES
TAVNTTLVVYDCQKSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAM
TLKWGPPKDDGGSEITNYVLEKRDSVNNKWVTCASAVQKTTFRVTRLHEGIEYTFRVSAE
NKYGVGEGLKSEPIVAKHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHIE
FKERNSLLWKRANKTPIRMKDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDP
IDPPGKPEVISVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAF
TVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTVKAG
DSIVLSAISILGKPLPKSSWSRAGKDIRPSDIAQITSTPTSSMLTVKYATRKDAGEYTIT
ATNPFGTKEEHVKVSVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKAYVLEKRE
TSRLLWTVVSEDIQACRHVVTKLIQGNEYLFRVSAVNHYGKGEPVQSEPVKMVDRFGPPG
PPGKPEISNVTKNTATVSWKRPTDDGGSEITGYHVERREKKGLRWVRATKTPVSDLRCKV
TGLQEGNTYEFRVSAENRAGIGPPSDASNPVLMKDVAYPPGPPSNAHVTDTTKKSASLAW
GKPHYDGGLEITGYVVEHQKVGDDAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAIND
AGVGEPAVIPNVEIVEKEVAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKD
NINLKHRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLN
LRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTVTTKCHKCTYKVTGLTE
GCEYFFRVMAENEYGVGEPTETTEPVRASEAPLPPDSLNIMDITKNTVSLAWPKPRHDGG
SKITGYVIEAQRKGSDQWTHISTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRP
VIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVN
VENTATSTILNINECVRSDSGPYPLTAKNTVGEVGDVITIQVHDIPGPPTGPIKFDEVSS
DFVTFSWEPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGVEYQFRV
RAQNRYGVGPGITSASVVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGY
HIERKERNGILWQTVSKALVPGNIFKSTGLTDGIAYEFRVIAENMAGKSKPSKPSEPMFA
LDPIDPPGKPVPLNITRHTVALKWAKPEYTGGFKITSYVVEKRDLPNGRWLKANFSNILE
NEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDLEAPRIMVDVRFKDTITL
KAGEAFKLEADVSGRPPPTMEWTKDGKELEGTGKLEIKIADFSTHLINKDSSRTDSGAYI
LTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQ
KRETSRLAWTNVATEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVDPYG
PPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKALTDLR
FKVSGLTEGHEYEFRIMAENAAGISAPSATSPFYKACDTVFKPGPPGNPRVLDTSRSSIS
IAWNKPIYDGGSEITGYMVEIALPEEDEWQVVTPPAGLKATSYTITSLIENQEYKIRIYA
MNSEGLGEPALVPGTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVK
WAREHGESLDKASIESTSSYTLLVVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPG
PPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVD
QLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLTDVTRNSVSLSWEKPE
HDGGSRILGYIVEMQSKGSDRWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPR
QLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKIDVPFIGRPPPAVTWHKDDIPLKQTTR
VNAESTENNSLLTIKEACREDVGHYTVKLTNSAGEATETLNVIVLDKPGPPTGPVKMDEV
TADSVTLSWEPPKYDGGSSINNYIVEKRDTSTTAWQIVSATVARTTIKACRLKTGCEYQF
RIAAENRYGKSTYLNSEPVVAQYPFKVPGPPGTPFVTLASKDSMEVQWHEPVSDGGSKVI
GYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEFRVSAENIVGIGKPSKPSECY
AAHDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNI
IDTQFEVTGLLEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPRISMDPKYRDTV
VVQAGESFKIDADIYGKPIPTTQWVKGDQELSSTARLEIKSTDFATSLSVKDAVRVDSGN
YILKAKNVAGEKSVTINVKVLDRPGPPEGPVAISGVTAEKCTLAWKPPLQDGGSDITNYI
VERRETSRLVWTLVDANVQTLSCKVLKLLEGNEYIFRIMAVNKYGVGEPLESESLIAKNP
FVVPDAPKAPEVTAVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGE
LRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVMDVTRSS
VFLSWTKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNLEVEKLLEKHEYNFRI
CAINKAGVGEHADVPGPVMVEEKLEAPDIDLDLELRKVINIRAGGSLRLFVPIKGRPTPE
VKWGKVDGDIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDT
PSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWK
IDQLQEGCSYYFRVTAENEYGIGLPARTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTK
PEHDGGSKIIQYIVEMQAKNTDKWSECARVKSLDAVITNLTQGEEYLFRVIAVNEKGRSD
PRSLAVPIIAKDLVIEPDVRPAFSSYSVQVGQDLKIEVPISGRPKPSISWTKDGMPLKQT
TRINVTDSLDLTTLSIKETHKDDGGQYGITVSNVVGQKTAAIEIITLDKPDPPKGPVKFD
EISAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEY
QFRIFAENRYGQSFALESEPVVAQYPYKEPGPPGTPFVTAISKESMVVQWHEPINNGGSP
VIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSE
CYVARDPCDPPGTPEAIIVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPEGRWMKASFT
NVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRD
TIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG
GQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTAEKCTLAWSPPLQDGGSDISH
YVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNKYIFRIMAVNKYGVGEPLESAPVLMK
NPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRI
TDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHVVDTTK
NSITLAWSKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEIAKLIEHQEYKI
RVCALNKVGLGEAASVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPT
PEITWSKEEGEFTDKVQIEKGINFTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVL
DTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCNKTS
FRVENLTEGAIYYFRVMAENEFGVGVPTETSDAVKASEPPSPPGKVTLTDVSQTSASLMW
EKPEHDGGSRILGYVVEMQPKGTEKWSVVAESKVCNAVVSGLSSGQEYQFRVKAYNEKGK
SDPRVLGIPVIAKDLTIQPSFKLPFNTYSVQAGEDLKIEIPVIGRPRPKISWVKDGEPLK
QTTRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTATENLSVIVLEKPGPPVGPVK
FDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTNWQMVSATVARTTIKISKLKTGT
EYQFRIFAENRYGKSTPLDSKPVVVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGG
SKVTGYHLEQKEKNSILWVKLNKIPIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKV
SECYVARDPCDPPGRPEAIVITRNSVTLKWKKPVYDGGSKITGYIVEKKDLPDGRWMKAS
FTNVVETEFTVTGLVEDQRYEFRVIARNAADNFSEPSESSGAITARDEIDAPNASLDPKY
RDVIIVHAGETFVLEADIRGKPIPDIIWSKDGNELEETAARMEIKSTLQKTTLIVKDCIR
TDGGQYTLKLSNVGGTKTIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGAS
ISHYIIEKRETSRLSWTQVSNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPV
IACNPYKRPGPPSTPEASAITKDSMVLTWTRPVDDGGAEIEGYILEKRDKEGIRWTKCNK
KTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTD
TSRSSVSLAWNKPIYDGGAPVRGYVIELKKAAADEWTTCTPPSGLQGKQFTVTKLKENTE
YNFRICAFNTEGVGEPATIPGSVVAQERMEAPEIELDADLRKVVTLRASATLRLFVTIKG
RPEPEVKWEKAEGILTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNV
RVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCT
KNTFKIENLQEGCSYYFRVLASNEYGIGLPAETAEPVKVSEPPLPPGRVTLVDVTRNTAT
IKWEKPESDGGSKITGYVVEMQTKGSEKWSACTQVKTLETTISGLTAGEEYVFRVAAVNE
KGRSDPRQLGVPVIAKDIEIKPSVELPFNTFNVKANDQLKIDIPFKGRPQATVAWKKDGQ
VLRETTRVNVASSKTVTTLSIKEASREDVGTYELCVSNTAGSITVPITVIVLDRPGPPGP
IRIDEVSCDNVSISWNPPEYDGGCQISNYIVEKRETTSTTWQVVSQAVARTSIKIVRLTT
GSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMVVSWQVPVND
GGSQVIGYHLEYKERSSILWSKANKVLIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCS
KACEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPRYDGGAKITGYIVERRELPDGRWLK
CNFTNVQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDV
KFRDVIIVKAGEVLKINADIAGRPLPVISWAKDGVEIEERAKTEIVSTDYTTTLTVKDCV
RRDTGQYVLTLKNVAGTRTMAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGA
DIDYYIVEKRETSRLAWTICEAELRTTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESMA
VKALDPFTTPSPPTSLEITSVTKDSMTLCWSRPETDGGSDISGYIIERREKNSLRWMRVN
KKPVYDLRVKSTGLREGCEYEYRVFAENAAGLSLPSETSPLVRAEDPVFLPSPPSKPKIV
DSGKTTITIGWVKPLFDGGAPITGYTVEYKKSEETDWKVAIQSFRGTEYTMSGLTTGDEY
VFRVRSLNKMGASDPSDSSDPQVAKEREEEPVFDVDSEMRKTLIVKAGSSFTMTVPFRGR
PIPNVSWSKPDTDLRTRAYIDSTDSRTLLTIENANRNDSGKYTLTIQNVLSAASMTFVVK
VLDSPGPPANITVREVTKETAMLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNR
LSYKVTNLQEGAIYYFRVSGENEFGVGVPAETKEGVKITEKPSPPEKLGVTSVSKDSVSL
SWLKPEHDGGSRIIHYVVEALEKGQKTWVKCAVVKTTHHVVSGLRESHEYFFRVFAENQA
GLSDPRELLLPVLIKDQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRD
GVPLKATMRFNTEITAENLTINLKESVTTDAGRYEITAANSSGTTKTFINIIVLDRPGPP
TGPVAISDITEESVTLKWEPPKYDGGSHVTNYIVLKRETSTAVWSEVSATVARTMIKVMK
LTTGEEYQFRIKAENRFGISDHIDSVCVVVKLPYTTPGPPSTPWVSNVTRESITVGWHEP
VSNGGSAVTGYHLEMKDRNSILWQKANKMIIRTTHFKVTTISAGLIYEFRVYAENAAGIG
KPSHPSEPVLAIDACEPPRNVRITDISKNSVNLSWQQPAFDGGSKITGYIVERRDLPDGR
WTKASFTNVIETQFTVSGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYGGPVID
LPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNALVCVENSTDLASILIK
DANRLNSGSYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADD
GGAKITHYIVEKRETSRVVWSMVAENLEECIVTTTKIIKGNEYVFRVRAVNKYGIGEPLE
SEPVVAKNAFVTPGPPSIPEVTKITKNSMTVVWDRPTVDGGSEINGYFLERRDKKSLAWL
KVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPIDPPGPPAKI
RIADSTKSSITLGWSKPVYDGGSDVTGYVVEMKQGDEEEWTIVSTRGEVRTTEYVVSNLK
PGVNYYFQVSAVNCAGQGEPITMTEPAQAKDVLEEPEIDLDVALRTSVIAKAGEDVQLLI
PFKGRPPPTVTWRKDEKNLGSDTRYSIQNTDSSSLLVIPQVTRNDTGKYILTIENGVGQP
KSSTVSVKVLDTPAACQKLQVKHVSLGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWS
VVSHKCSGTSFKVTDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKD
STKTSVVLSWTKPDFDGGSIITDYLVERKGKGEQAWSHAGISKTCEIEIGQLKEQSVLEF
RVSARNEKGQSDPVTIGPLTVKELVITPEVDLSEIPGAQISVRIGHNVHLELPYKGKPKP
SISWLKDGLPLKESEYVRFSKTENKITLSIKNSKKEHGGKYTVILDNAVCRNSFPITIIT
LGPPSKPKGPIRFDEIKADSAIMSWDIPEDDGGGEITCYSIEKREASQTNWKMVCSSVAR
TTFKVSNLVKDSEYQFRVRAENRYGVSEPLASNIIVAKHQFRIPGPPGKPVIYNVTSDGM
SLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNTSPISGREYRATGLIEGLDYQFRVYA
ENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEK
RQGSDRWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGLIMTRDEN
VPPTVEFGPEYFDGLVIKSGDSLRIKALVQGRPVPRVTWFKDGVEIERRMNMEITDVLGS
TSLFVRDATRDHRGVYTVEAKNVSGSTKAEVTVKVQDTPGKVVGPIRFTNITGEKMTLWW
EAPLNDGCAPVTHYIIEKRETSRLAWALIEDNCEALSYTAIKLITGNEYQFRISAVNKFG
VGRPLESDPVVAQIQYTIPDAPGVPEPSNVTGNSITLTWTRPESDGGSEIQHYILERREK
KSTRWVKVISKRPISETRFKVTGLVEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNP
PSAPSVVKVTDTSKTTVSLEWARPVFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRY
TVTDLQAGEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGV
SIRLFIAYQGRPTPTAVWSKPDSNLSIRADIHTTDSFSTLTVENCNRNDAGKYTLTVENN
SGKKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVIEKREASRR
SWQVVSEKCTRQILKVSELTEGVPYYFRVSAENEYGVGEPYEMPEPIVATEQPAPPRRLD
VVDTSKSSAVLAWLKPDHDGGSRITSYLLEMRQKGSDFWVEAGHTKQLTFTVERLVENTE
YEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISG
RPAPKVTWKLEEMRLKETDRMSIATTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFTI
TVVVIGRPGPVTGPIEVSSVSAESCVLSWTEPKDDGGTEITNYIVEKRESGTTAWQLINS
SVKRTQIKVTHLTKYKEYCFRVSSENRFGVSKPLESVPIVAEHPFVPPSAPTRPEVYYVS
ANAMSIRWEEPYHDGGSKIVGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQF
RTYALNAAGVSKASEASRPIMAQNPVDPPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGY
IIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTG
PVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEK
ISLQYTGKRATAVIKYCDRSDSGKYTLTVKNASGTKSVSVMVKVLDSPGPCGKLTVSRVT
EEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECLTASYVVTRLIKNNEYTFR
VRAVNKYGLGVPVESEPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISN
YLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFI
SCREPSYTPGPPSAPRVVDTTKRSISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWCRVHT
NATIRNNEFTVPDLKMGQKYSFRVAAVNAKGMSDYSETTAEIEPVERLEIPDLELADDLK
KTVIVRAGASLRLMVSVSGRPSPVITWSKKGIDLANRAIIDNTESYSLLIVDKVNRYDAG
KYTIEAENQSGKKSATVLVKVYDTPGPCPSVSVKEVSRDSVTITWEIPTIDGGAPVNNYI
IEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSE
VPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLE
HTVISLNEGEQYLFRVRAQNEKGVSEPREIVTPVTVQDLRVLPTIDLSTMPQKTIHVPAG
RPIELVIPITGRPPPTASWFFAGSKLRESERVTVETHTKVTKLTIRETTIRDTGEYTLEL
KNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRD
AHRPGWLPVSESVTRPTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSISIPG
PPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRS
TGLIEGLEYEHRVTAINARGTGKPSRPSKPTVAMDPIAPPGKPQNPRVTDTTRTSVSLAW
SVPEDEGGSKVTGYLIEMQKVDQREWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAG
GPGEPAEVPGTVKVTEMLEYPDYELDERYQEGVFVRQGGVIRLTIPIKGKPFPVCKWTKE
GQDISKRAMIATSETHTELVIKEADRNDSGTYDLVLENKCGKKTVYIKVKVIGSPNTPEG
PLEYDDIQARSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLK
ENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRP
KDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLS
ETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSG
DSAWKKSNKERIKDRQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTSGEAP
GVRKEMADVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVM
TDEQEDEGVYTCVATNEVGEVESSSKLLLQAAPQFHPGYPLKEKYYGAVGSTLRLHVMYI
GRPVPAMTWFHGQKLLQNSEKITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNAFGTVDA
TLDVEIQDKPDKPTGPIVIEALLKNSVVISWKPPADDGGSWITNYVVEKCEAKEGAEWQL
VSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISEPLEVASIVIIKSPFEKPGVPGKPTI
TAVTKDSCVVAWKPPASDGGAKIRNYYLERREKKQNKWIAVTTEEIRETVFSVQNLIEGL
EYEFRVKCENLGGESEWSEISEPVTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTG
HPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSG
TASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGH
YQVIVTRSFTSLVFSNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDV
SRDSVNLTWTEPASDGGSKVTNYIVEKCATTAERWLRVGQARETRYTVINLFGKTSYQFR
VIAENKFGLSKPSEPSEPTVTKEDKTRAMNYDDEVDETREVTTTKASHSKTKELYEKYMI
AEDLGRGEFGIVHRCVETSSKRTFMAKFVKVKGTDQVLVKKEISILNIARHRNILYLHES
FESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVRQVCEALEFLHSQNIGHFDIR
PENIIYQTRKNSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSL
GTLVYVLLSGINPFLAETNQQMIENIMNAEYTFDEEAFKEISLEAMDFVDRLLVKERKSR
MTASEALQHPWLKQRIDRVSTKVIRTLKHRRYYHTLIKKDLNMVVSAARISCGGAIRSQR
GVSVAKVKVASIEIGPVSGQIMHAIGEEGGYVKYVCKIENYDQSTQVTWYFGVRQLENSE
KYEITYEDGVATMYVKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTK
KVKRRTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGD
DEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLR
PMFKRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALH
IRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYVKQEFQSKEERERHVQKQIDKTLR
MAEILSGTETVPLTPVAQEALREAAILYKPAVSTKTVKGEYRLQTEEKKEERKLRMPYEV
PEPRRFKQATVEEDQRIKQFVPMSDMKWYKKIRDQYEMPGKLDRVVQKRPKRIRLSRWEQ
FYVMPLPRITDQYRPKWRIPKLTQDDLEMVRPARRRTPSPDYDLYYYRRRRRSLGDMSDE
ELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSRSPPRFELSSLRYSSPPAHVKVED
RRRDFRYSTYHVPTKEETSTSYAELRERHAQASYRQPKLRQRIMAEKEEEELLRPVTTTQ
RLSEYKSELDYMSKEEKSKKKSKRQRQVTEITEIEEEYEISRRAQRESSSSVSRLLRRRR
SLSPTYIELMRPVSELIRSHPRPAEEYEDDAERRSPTPERTRPRSPSPVSSERSLSRFER
SARFDIFSRYESMKAALKTQKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRF
ILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCQTEDGGTYRAVCTNYKG
EASDYATLDVTGGAYTTYASQRRDEEVPKSVFPELTKTEAYAVSSFKRTSELEAASSVRE
VKSQMTETRESLSTYEHYASAEMKSATSEEKSLEEKATVRKIKTTLAARILTKPRSITVH
EGESARFSCDTDGEPVPTVTWLREGQVVSTSARHQVTTTKYKSTFEISSVQASDEGNYSV
VVENSDGKQEAQFTLTVQKARVIEKAVTSPPRVKSPEPRVKSPETVKSPKRVKSPEPVTS
HPKAVSPTETKPTEKGQHLPVSAPPKITQSLKAEASKDIAKLTCAVESSALCAKEVAWYK
DGKKLKENGHFQFHYSADGTYELKIHNLSESDCGEYVCEVSGEGGTSKTSFQFTGQSFKS
IHEQVSSISETTKSVQKTAESAEAKKSAQKTAESVEDKKAAQKTVESAEAKKPAQKTAES
PEAKKPAQKTAESPEAKKQEPIAPESISSKPVIVTGLRDTTVSSDSVAKFTIKVTGEPQP
TITWTKDGKAIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTI
KAVKDTEAQKVSTQKTSEVTSQKKASAQEEISQKALTSEEIKMSEVKSHETLAIKEEASK
VLIAEEVKRSAAASLEKSIVHEEVTKTSQASEEVKTHAEIKTLSTQMNITKGQRATLKAN
IAGATDVKWVLNGTELPNSEEYRYGVSGSDQTLTIKQASHREEGILSCIGKTSQGVVKCQ
FDLTLSEELSDAPSFITQPRSQNINEGQNVLFSCEVSGEPSPEIEWFKNNLPISISSNIS
VSRSRNVYTLEIRNAAVSDSGKYTIKAKNFHGQCSATASLTVLPLVEEPPREVVLKTSSD
VSLHGSVSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSS
SFMGKSSMTQLESSTSRMLKAGGRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEIT
WSCGGRKIQNQEQQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINI
RSM
NT seq 106392 nt   +upstreamnt  +downstreamnt
atgactactcaagcaccgatgtttacgcagccgttacaaagcgttgtggtactggagggt
agtaccgcaacctttgaggctcacgttagtggttccccagttcctgaggtgagctggttt
cgggatggccaggtgatttcaacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctagattgatgatccccgccgtgactaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttcttgtgacagccgag
acagcaccacccaacttcagtcagcggctgcagagcatgactgtgagacaaggaagccaa
gtgagactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggat
ggagccgaaatccagagctcccttgatttccaaatttctcaagaaggagacctctacagc
ttactgattgccgaagcataccctgaagactccgggacctattctgtaaatgccaccaac
agcgttggaagagctacttccactgcagaattggtggttcaaggtgaagaagtagtacct
gctaaaaagacaaagacgatcgtgtcgactgctcagatttcagaaacaagacaaacccgg
attgaaaaaaagattgaagcccactttgatgccagatcaatcgcaacagttgagatggtc
atagatggtgccactggacagctgccacataaaacacctcccaggatacctcctaagccc
aagtccaggtctccgacaccaccttccattgctgccaaagcacagctggccagacaacag
tccccatcaccaataagacactctccctccccagtcagacacgtgcgggcaccaacccca
tctccagtcaggtccgtgtctccagcggggaggatctccacttccccgatcagatccgtg
aagtcgccactgctcattcgcaagactcagaccaccaccatggccacaggccccgaggtg
cctcccccttggaagcaagagggctacgtggcctcctcgactgaggctgagatgagagag
acgacaatgacaagctctacccagatcagaagagaagagaggtgggaagggagatacggg
gtccaggagcaagtgaccatcagtggagccgcggctgctgcggccagtgcgtcggtcagc
tcgtcattcacggcaggagccatcaccactgggactaaggaggtgaaacaagagacagac
aagagtgcagctgttgcgactgtcgttgctgctgttgatatggccagagtgagagaacca
gccatcagtgctgtagagcaaactgctcagaggacaaccacgactgctgtgcatatacaa
cctgctcaagaacaggcgagaaaagaggcggagaagaccgcagtaaccaaggttgtagtt
gctgccgataaagccaaggaacaggaactaaaatcacgaaccagagaagtgatggtgaca
acgcaagagcagactcacatatctcatgagcagataagaaaagaaactgaaaaagcattt
gtaccaaaggtagtgatctccgcaaccaaagccaaagagcaagaaactagaatcacggga
gaaattactacaaaacaagagcaaaagcgaataactcaagaaacaataagacaggaaact
gaggaaattgctgcatccatggtagtggttgccaccgccaagtccacaaaactagaggca
gctgtgggagttcaagaagagactgccatacaacaggatcaaatgcacctcactcatgaa
cagatgatgaaggaaactaggaaaacagtggtacccaaagtcatagttgccacgcccaag
attaaagagcaagatttagtatcaagaagtagagaagccatcactaccaaaagagatcaa
gttcaaataactcaggaaaagaagagaaaggaagtggaaacaactgccttgtctacaata
gcagttgctactgctaaagccaaagagcaagaaacagttctgaggtctagagaagccatg
gccactagacaagaacacatccaagttacccatggacaggtgggcgttgggaagaaggca
gaagccgtggcaacagttgtagctgctgtggaccaggcccgagtgagggaacccagagag
cctacgcatgtggaggaatcgcattctcagcagactacgttagagtatggctacaaagaa
cacatttccaccacaaaggtcccagagcagccccggcgcccagcctcagagccccacgtt
gtccctcaagcagtcaagcctgctgtgattcaggctccttctgagactcatatcaaaact
actgaccaaatgggaatgcatatatcgtcacaggtcaagaaaactacagatatctcaaca
gaaagattagttcatgtggataaacgcccccgcacagcgagccctcactttactgtttca
aaaatttctgtacctaagacagaacatggatatgaggcatcgatagctggtagcgctatc
gccacactacaaaaagaattgtcagccacatcttcaactcagaagatcaccaaatccgtg
aaggcacccaccgtgaagcctggggagacgagagtaagggcggagcccaccccttcccca
cagttcccctttgctgacatgccgccgccagacacttacaagagtcaggctggcattgag
gtgaagaaggaagtcggggtgagcatcagtggcagcaccgttcgtgaggagcacttcgaa
gtactgcgcggacgtgaagccaaggtaacagagacagcacgagtgcctgctcctgctgaa
gtgcctgttactccgcctaccttggtctcgggcttaaaaaacgtgactgtcatagaaggc
gaatctgtcaccttggagtgccacatctctggatacccatcccccaaggtgacatggtac
agagaagactaccaaatcgaaagttccattgatttccagataaccttccagggtggaatt
gctcgtctcatgatccgcgaagcctttgcggaagacagcggacggtttacctgcagcgcc
gtgaatgaggccgggaccgtcagcacttcctgctatcttgctgtgcaagtgtcagaagag
tttgacaaggaaacaactctgactgagaaatttgccaccgaagagaaacgcttcgtggag
tcaagagatgtagtcatgaccgacaccagcatcacagaggagcaggcagggcctggagag
cctgctgcgcctttcttcatttcaaagccggtggtccagaaactggtggagggtgggagt
gttgtgtttgaatgccagatcggcggcaacccaaagccccacgtctactggaaaaaatct
ggcgttcctctcaccactggatacagatacaaagtgagttataacaagcagactggggaa
tgcagactggtgatttctatgacgttcgctgatgatgctggagaatacactattgtcatc
cgaaacaagcacggggagacgtctgcatctgcctccttgctggaggaagctgattacgag
gcattggtgaagactcagcaagaaatgctttaccagacacaaatgagcacatttattcaa
gaacccaaagtgggggaaatagcacctggatttgcatattctgaatatgagaaggaatat
gaaaaggaacaggccttaattaggaagaaaatggccaaagatactgtgatggtcaggact
tttgtagaagaccaagaattccacatctcttcttttgaagagaggctcattaaagagatt
gaatacagaataataaagactacgctggaagaacttcttgaggaggatggagaagagaag
atggcagtcgacatttctgaatctgaagctatcgagtcaggatttgatataaggataaaa
aattatagaattcttgaggggatgggtgtcacttttcattgcaagatgtctggatatccg
ttacccaagattgcgtggtataaggatggcaagcgcatcagacatggggaaagatatcaa
atggactttctacaagatggcagagccagcctgcgtatacctgttgtccttccagaggac
gagggcatctatactgcatttgccagcaatatcaaaggaaatgcgatttgctctgggaag
ctgtacgtggagcctgctgcaccatttagcgctccaacttacatgcccacaccagaagca
gtgagcagaatcaggtctgtctctccacgttcactgagcaggtcacctatacgtatgtct
cctgcgatgtcccctgcacgaatgtcccccgcacggatgtcccctgcacggatgtccccc
gcacggatgtctcctggacgcaggctggaggagacagatgaatcacagctggagagactg
tataagccagtctttgtattaaaacctgcttctttcaaatgtttagaaggacagactgcc
agatttgacttgaaggttgtgggcagacccatgccagagacattctggtttcacaatgga
cagcaaattgtcaatgattatacgcacaaagtcgtcattaaagaagatggaactcagtca
ctgatcattgtccctgcgtcacccagcgattcaggagaatggacagtggtggcccaaaac
agagcaggaaaatccacaatatctgtgactttaactgtagaagctgtggaacaccagatc
aagccagcatttgtggaaaaactgaaaaatgtcaacataaaggaaggttccaggctcgaa
atgaaagtcagagctacaggcaaccccaaccctgacattgtgtggctgaaaaacagtgac
atcattgttcctcataaatacccaaggatcaggattgaaggaaccagaggagaagccgcc
cttaagattgattccattatcagccaagattcagcctggtatacagccacggctattaac
aaggcaggccgagacaccacaaggtgcaaagtcaatgttgaggttgagtttgcagaacct
gaaccggaaagaaagctgattattccacgaggaacgtacagagcaaaggagattgctgcc
ccagaactggagcctctccatttgagatacggtcaagaacagtgggaggagggtgacctc
tatgacaaggagaaacaacagaaaccgtttttcaagaaaaaactcacttccctcagactg
aagcgctttggacctgcccactttgagtgcagactcacaccaattggtgacccaaccatg
gtggtggagtggcttcacgatgggaagcccctggaggcggccaacaggcttcggatgatt
aatgaattcggctactgcagccttgattatggagcagcgtattccagagacagtggtgtc
atcacctgcagagctactaacaaatatgggacagatcacacctctgctactcttattgtc
aaagatgagaaaagcctagtggaagaatctcaactgcctgatgggaaaaaaggcttacag
aggatagaagaactagagagaatggctcacgaaggtgcgctgacaggtgtgacaacagat
caaaaagaaaaacaaaagccagacattgtcttgttcccagagccagtgagagtgctggaa
ggggagacagccagattccgctgccgagtgacaggctaccctcagcccaaggtcaactgg
tacctcaatggacagctcatccggaaaagcaaaaggttcagagttcgctatgatggcatt
cactatctggatattgtggactgcaaatcctatgacacaggtgaagtcaaggtcactgcg
gaaaatcctgaaggtgtgacggaacacaaagtaaaacttgaaatccaacagagggaggat
ttcagatctgtccttaggcgtgctcccgagccaaagcccgagtttcatgtacacgaaccg
gggaaacttcagttcgaagtgcagaaggtagacagacccgtggacaccagcgaaaccaaa
gaagtggtgaagctgaaaagggctgaaaggattacccatgagaaggtgtccgaggagtct
gaagaactgcgcagtaaatttaagcgccggacggaagagggatactatgaagccatcaca
gccgtggagctgaagtctcgcaagaaggatgagtcttacgaagagctcctcaagaaaact
aaagatgagcttctgcactggaccaaagagttaactgaagaggagaagaaagccttggct
gaagaaggcaaaatcacgattccaacctttaaacctgagcgaatcgaacttagccctagt
atggaggcacccaaaatctttgaacgaatccagagccagaccgttggccaaggatctgat
gctcactttagagtcagggttgtgggaaaaccagaccctgagtgtgaatggtataaaaat
ggtgtaaaaattgagcgatctgaccgaatctactggtactggccagaagacaatgtttgt
gaactggtcataagagatgtaactgcagaggactctgccagcatcatggtaaaggccatc
aacatagctggggaaacctcaagccacgcattcctgctcgtccaagccaagcaactgatc
acttttacacaagaattgcaagatgttgttgctaaggaaaaggacaccatggcaacattt
gaatgtgaaacttcagaaccatttatcaaagtaaaatggtataaagatggtatcgaagtt
catgcaggggataagtataggatgcactctgaccgaaaagttcacttcctgtctgtgctg
accatcgacacatctgatgctgaagactacagctgtgtacttgtggaagatgaaaatatc
aagacgacagcgaaacttattgtggaaggtgcagtagttgaatttgtgaaagaacttcag
gacatagaagtcccagagtcatactcaggagagttagagtgcatcatatctccagaaaac
atagaaggcaaatggtatcacaatgatgtggagttgaagtccaatggcaaatactcaatt
acatcccgccgtgggcgccagaacctcacagtcaaggatgtaaccaaagaggaccaggga
gagtacagctttgttgttgatgggaaaaagacaacctgtaaactgaagatgaaaccccga
cctattgctattctccaaggacttagcgatcaaaaggtctgcgagggtgacattgttcaa
cttgaagtcaaagtctccttagaaaatgtagaaggtgtctggatgaaagatggtcaagaa
gtacaacacagtgacagagttcacattgtaatagacaagcagtcccacatgctacttatt
gaagacatgaccaaagaagatgctgggaattactccttcactattcctgcccttggactc
tccaccagtgggaatgtctctgtctatagtgttgatgtgataacacctctcaaagatgtc
aatgtgattgaaggtaccaaggctgtacttgaatgcaaggtctcagttcccgatgtaact
tctgttaaatggtacctaaatgatgaacaaatcaagcctgatgatcgtgtgcaatccatt
gtcaaaggcaccaaacagcgacttgtgattaaccgaacccatgcttctgatgaaggacct
tacaagctgatggttggcagggtggaaaccagctgtaacctgtctgtagagaaaattaaa
attatcagaggtctccgtgaccttacctgcacagaaacacaaaatgtggtctttgaggtt
gagctatcccactcaggaattgatgttgtatggaattttaagggcaaggaaattaagccc
agttctaaatataaaattgaagctcatgggaaaatatacaaactgacagtcctcaatatg
atgaaagatgatgaaggggagtatgcattctatgcaggagaaaatacaacatctggaaag
ctaactgtggcaggaggagccatctccacaccactcacagaccagactgtggctgaatcc
caggaggctgtgtttgaatgtgaagttgccaaccctgagtctgagggggaatggctgaag
gatggaaagcacttggctctgagtaacaacttcagaggtgaatccgatggccacaaaagg
aggcttgtcatcgctgccgccaagttagatgacgctggagaatatacctacaaggtggct
acctccaaaacatctgccaagctgaaagttgaagctgtcaaaattaagaagaccctgagg
aacctcactgtgacagagacacaggatgcagtcttctctgttgaactcacacacccagat
gtcaaaggggtccagtggatcaaaaacggagttgtcttagattccaacgacaagtatgag
atctcagtcaaagggacactttattcactgaagattaaaaactgtgccatggcagatgaa
tctgtctacggcttcaaactggggaggctaggagctagcgcccggctgcacgttgagact
gtcaagattattaagaaaccaaaggacgtgaccgccttggaaaacgccactgttaccttc
gaagtcagtgtttcccatgacacggtgccagtaaaatggttccataagaacgtggagatt
aagccaagtgacaagcacagactggtctcagagagaaaagtccacaaactcatgcttcag
agcatctccccctcggatgccggcgagtacacagccatggtgggccagctggagtgcaaa
gccaagctgtttgtggagacactccatatcacaaagactatgaaaagtatcgaggttcct
gaaaccaaagctgcctctttcgagtgtgaggtgtcccacttcaatgtcccctccatgtgg
ctaaagaacggagtggaaattgagatgagtgaaaaattcaagatcgtcgtgcaggggaaa
ctgcaccagctgatcatcatgaacacgagcacggaggactcagcggaatacacatttgtt
tgtggcaatgaccaagtcagtgctaccctgacagtgaccccaatcatgattacatccatg
ctgaaagacatcaatgctgaagaaaaagataccataacttttgaggtgacagtaaactat
gaaggcatctcttacaaatggttaaagaacggtgtggagatcaagtcgactgacaggtgc
cagatgagaaccaagaagctcacgcactcgctgaacatcaggaatgttcactttggagat
gctgctgattatacttttgtggctggaaaagccacatcgacggccaccctttatgtggaa
gctcgtcatatagaatttaggaaacacattaaggatattaaggttctggagaagaaacga
gccatgtttgaatgtgaagtttctgagcccgacataactgttcagtggatgaaagatggc
caagagcttcagatagcagacaggataaagatccagaaggagaaatatgtccaccgcctt
ctgatcccatccacacgcatgtctgatgccgggaaatatacagtggtggcaggaggcaac
atgtcaactgctaacctctttgtcgaaggcagggatgtccgcatccggagcattaagaag
gaggtccaggtcattgagaagcagcgtgctgtcgtggagttcgaagtcaatgaggatgac
gtagacgcccactggtataaagatggcattgaaatcaacttccaagttcaagagcgacac
cagtatgtggtggagagaagaattcaccggatgtttatatcagaaacaagacacagtgac
gcaggcgaatacacctttgtggcaggcagaaacaggagttctgtgactctttatgtcaat
gctccagaaccaccccaagtcctgcaggaactccagcctgtcactgtacagtccggcaag
ccggctcgcttctgcgccgtgatatcaggcagaccgcagcccaaaatttcctggtacaag
gaggagcagctgctttccactggcttcaagtgcaaatttctgcacgacgggcaggagtac
acacttctgctcattgaggctttcccagaggatgcggcagtctacacctgtgaagccaag
aatgactacggagtagccacaacgtcggcttctctgtccgtggaagttccagaagttgta
tctccggatcaggaaatgccagtctacccgcctgccatagtcactccacttcaggacaca
gttacttctgaggggcgcccagcgcgtttccagtgccaagtttcagggacagatttgaag
gtgtcttggtactgcaaagacaagaaaatcaaaccatctcggttcttcaggatgacccag
tttgaagacacctaccagctggagatcgctgaagcctaccccgaggacgagggaacgtat
gcctttgttgctaataatgctgtgggccaagtgtccagcactgccaccctgaggctggaa
ggatttagcaaatctgaagaagttacatcaaaatcccaatggcatacctcaccatcagtc
tcacttaagaaggaggcccttggccaaaagcccatcttcatccagcctctgtcaagcctc
agggtgcacagcggggagacagtcagatttcacgcgagggtttctggtgttcccaagcca
gcaatccagtggtttcataaccaccagccaattctaccatcaaaagatgtagttttccat
tttgaggaatccacaggcatggctttaatgcttatagttgatgcttacccagagcatgct
gggaaatactcttgcagagcagccaatagtgctggggaagccacttgtgcagctacgctc
acagtgactgcaaaagcccccgagtcgattctgcatgagaggatcggccagcaaatcgaa
atggagatgaaagaaattgctagccttctgtccgccgaggaagattttcaaacctatagt
tctgatctacgtttacctaatgcgaatgaaacacttgaacttctgtctgagcctccagct
cgttccacccagtttgattccagacaggaaggcgctgccccagttttcatcagagaaata
tcagacgttgaaataagcgtcgaagatgtagctaaattgtctgttactgtcactggctgc
cccaagcctaaaattcaatggttctttaatgggatgctgttaaccccttctgctgactac
aaatttgtctttgatggggatacccacagcctaatcattctgttcaccagatttcaggat
gagggggagtacacgtgcctggccagtaatgaatatggaaaggcagtgtgtagcgctcac
ctaagaataagtcccagaggagagaggagcacggagatggagtcaggagagaaaaaggct
ctggaaaagcccaaagggccttgtcctccttattttttcaaggaattaaaaccagtgcac
tgtggcccaggaatccctgctgtctttgagtactcggtgcacggagagcctgcccccact
gtcttgtggttcaaagaagacatgccactttataccagtgtttgctacaccatcattcac
agtcctgacggatccgggaccttcatcgttaatgacccacagaggggagatagtggcctg
tacctctgtaaagcccagaacctctggggggagtccacctgtgccgcagagcttcttgtg
cttccagaagacacagatgtgcccgatgcctcctgcaaggaagagtccaccttaggagtt
cctggtgattttctggaaacatctgccaggggccctttagttcagggagttgactcacgg
caggaaattacagcttttgccgagggtaccatttcgaaagctgctttaattgcagaggaa
acgctgcagctttcttacgagcgtagtgttgatgacagtgaagtgggtactggggtgacc
ataggggcccagaagctgccgcctgttgtattgtccactccccagggcactggggagctg
ccttccattgatggtgcagttcacacacagccaggcagaggaccaccccccactttaaac
ctgcaggcagtccaggctcagacaaccctccccaaggaagctactctacagtttgaagag
cctgagggagtcttcccaggtgcctcatctgcagcacaagtgagtccggtcaccatcaaa
cctctgataaccttaacagctgaacccaaagggaattatccacagtcttccacagcagct
cctgatcatgcacttctgtcctctgtggctgcagaaacacttcagctaggagaaaagaaa
atcccagaagtggacaaagcacaaagagctctcctcctgagtcagagcttagctgaggga
tgtgtagaaagtttagaggttcctgatgttgcagtctctaacatgcgctctgagccccaa
gtccctttccaacatacatgcacagaaggcaagatcctgatggctagtgcagacactcta
aaaagcacagggcaagatgttgcactgaggaccgaggaaggcaagtccctaagcttccca
ctagcacttgaggaaaagcaggtcctacttaaggaagagcaatcagaggtcgtggcagtg
cccactagccaaacctctaagtctgagaaagagccagaggccataaagggagtgaaggag
gtacgagaacaggagctgctttctaaggaaacattgtttcctagtatgcctgaagagcag
cgattacatctgaaaactcaggtccgcagggctttgcaagctgccgtggccagggaacaa
gcaaatcttttctctgagtggctaagaaacattgacaaggtggaggtcacagccgtaaac
ttcactcaagagcccaagcgtatcctgtgcacctaccttattacctcagtgagctcacta
accgaagagttaaccgtcactattgaagacatagatcctcaaatggctaacctggaaact
ggactgaaggatgccttgtgctccattgtctgtgaagaaagaaacatcttaatggctgag
gatccgaggattcacgaagaagacaaaatagacgtgcaaggcggaagagatcacctttca
gatgcacagaaagttgaaaccgtcatagaggcagaagctgactctaagtaccttgtctcc
aaagaagaggtcagttggtcgaaagtggaaagtcaactcaaagatggagataccaatgag
gttccgcaggctgagactctgaaattagcagaagagagtggtacccagaagaccagtaca
gagatgtcacaagaagaagctgagggtaccttagctgacctttgccctgctgtccttaaa
cacttagtggataccatttctgaggaaggagatactgtccaccttacatcatccatatca
aatgctaaggaggtgcactggtatttcaagggtaacctggtgccctcagacggaaagttc
aagtgtttaaaggagcagaatgcctacactctggtaattgaggcagtaaagacggaggat
gaaggggagtatgtctgcgaagcctcaaatgacagtgggaaagcaaagacatcagcaaag
ctcactgtgggagaaagagctgcccctgtgatcaaaaggagaattgagcccctggaagta
gctctgggccacctggccaaattcacctgtgagatccaaggagcccccaacgtccggttc
cagtggttcaaagctggcagagagatctatgagagcgacaagtgttccattcgatcttcg
aactatgtctccagcctggagatcctgagaacccaggtcgttgactgcggggagtacacc
tgcaaagcctccaatgagtatggcagtgtcagctgcacagccacactaactgtgacagag
gcgtatccaccaacctttctctccaggcccaaggcccttacgactttcgtgggtaaggca
gccaagtttctctgcacagtgtcagggactccggtgattgagatcatctggcagaaagat
ggcgctgccctgtcaccgtcacctgactgcagggtcacagacgcagacaacaaacacagt
ttagaactctcaaatcttactgttcaggacaggggtatttactcttgtaaggcttccaac
aaatttggagcagatatctgccaggccgagttgaccatcattgacaaaccccacttcatt
aaagagttagaggctgtacagtcagccatcaataagaagatccaccttgaatgccaagtc
gatgaggataggaaagtcacaatcacatggagcaaagatgggcagaaacttcctgctggg
aaagattacaagatctattttgaagataaaatagcatcgcttgagattcccctggccaaa
ctaaaagattctggaacctatacatgtacagcgtccaacgaggctgggagcagttcttcg
tctgctgcggtcgctgtcagagaaccgccgtcctttgtgaagaaggtggatccctcttat
ttaatgctcccgggtgaatcagcacgcctccattgcaagctgaaaggctcacctgtgatc
caggtcacttggttcaaaaataacaaagaactcagtgagagtaacacagtccgcatgtct
tttgtcaattctgaggctatcctcgacatcactgatgtaaaggtcgatgacagtggtact
tactcctgtgaagccaccaatgacgtgggcagcgacagctgcagcactgaagtggtgatc
aaagagccgccttccttcatcaaaactcttgagcccgcagacatagtgcgaggggccaat
gcactgctccagtgtgagatcgcaggcacgggaccctttgaagttaactggtttaaagac
aagaagcagatccgaagtagcaaaaagtacaggttgtttactcagaagacttttgtgtac
ctggaaatctcatctttcaatagtgccgacgttggcgattacgaatgtgtagttgctaac
gaagtcggaaagtgtggctgtgtcgcgacacacttattaaaagaaccaccaacctttgtc
aagaaagtagatgattttacagccctagcaggacagaccgttaccttacaagctgccgtg
agagggtcagaacccatttctgtcatgtggatgaaaggccaagaagtcattaaagaagat
ggaaaaatcaaaatgagcttttccaatggagttgccgtcttgaccatccctgatgttcag
attagtttgggtggcaaatatacatgcctggctgaaaacgaagctgggagccaaacatct
gtcggggaattgatagttaaagaacctgccaaaatcattgagcgagcagaactaatccag
gtgaccgcaggagacccagccactctggagtacacagtctcaggcaccccagaactcaag
cccaagtggtacaaagatgggagacccttggttgctagtaaaaagtaccgaatcagtttt
aaaaacaacattgcccaactgaaattttattctgctgaactgcacgacagtggccagtac
acgtttgagatttccaacgaagtgggcagcagctcctgtgagaccacatttaccgtgtta
gatcgagacattgctccgcttttcaccaaacccttacgtaacgtggacagtgtcgttggc
ggtgcctgcaggttagactgcaaaattgctggctccctccccatgagggtttcctggttt
aaggatggcaaagagctcactgcttccgacagataccagatagcatttgtggaaggcaca
gcctctttggagatcagcagagtagacatgaatgatgcagggaatttcacctgccgggcc
accaattccgtgggaagcaaagacagcagcggagccctgattgtgcaagaaccacccagt
tttgtaactaagccagggtccagggatgtcctgcccggctcggcagtctgtctgaagagt
gctttccagggctccgcccctctcaccatcaagtggtttaagggcgacaaagagttggtt
tccggtggaagctgctatattaccaaagaaacttcagagagttccctggagctctacgca
gtgaaaacctcggattcgggcacttacacgtgcaaagtcagcaacgtagccgggagtgtg
gaatgcagtgcagacttgtttgtgaaagagcctgctacctttattgaaaagttagagcca
tcccaactgttaaagaaaggagatggcactcagctagcctgcaaggtcacgggtacccct
ccaattaagataacatggtttgcaaatgaccgagaactgagagagagcagcaaacacaaa
atgtcttttgcggagtccaccgcagttttaaggcttacggatgtggccattgaagacagt
ggagaatatatgtgcgaggcacaaaacgaggccggcagtgaccactgtactggcattgtc
atagtcaaagagtcaccttactttaccaaggaatttaagtccattgaagtattaaaggag
tatgacgtcatgctgctggctgaggtggcaggcacccctccctttgagatcacttggttc
aaggacaacacaaccctgagaagtggtagaaagtataaaaccttccttcaggatcagctg
gtcagcctgcaggtcctcaagtttgtagctgcagatgcaggtgaataccaatgccgggtg
accaacgaggtcggcagcagcacctgcagtgccagggtgacattaagagaacccccgtcc
ttcattaagaagattgaagccaccagctccctccgtgggggcacagccgccttccaggcc
actctgaaaggctccttgccaatcactgtgacctggttgaaagacaatgatgagatcact
gaagatgacaatataagaatgacttttgagaacaacgtggctagtctatacctcagtggt
attgaagtcaagcatgatgggaaatatgtctgtcaagccaaaaatgatgcaggcatacaa
aggtgttctgcattactctcagtcaaagaacctgcaacaataatggaggaggctgtgtcc
atagatgtcactcaaggagacccagccactttgcaagttaaattttcagggactaaggag
atttcagctaaatggtttaaagatggccaagaacttaccctgggtccaaaatacaaaatc
agtgtcactgacacagtctcaatactaaagattatttccacagagaagaaggatagtgga
gaatatacttttgaggtccaaaacgatgttgggagaagcagctgcaaggctagcattaat
gttttagatcttattatacctccttcattcaccaaaaaattgagaaaaatggacagcatt
aaaggatcttttattgacttagagtgtatagtggctggatcccatccaataagcatccaa
tggttcaaagacgaccaagaaatctcagctagtgacaagcacaaattctcttttcatgac
aataccgccttcttagagatcagtcagctggaaggcacagacagtggtacatatacctgt
tctgccaccaacaaggcaggccacagccagtgcagtggtcacctgacagtcaaagaaccc
ccttacttcgtggaaaagccacagtcacaagatgtgaatcccggtacgagggttcaattg
aaggctcttgtgggtggcactgcacccatgacaataaagtggtttaaagataacaaggag
ctgcaccctggggcagctcgctcggtttggaaggatgacacctccaccattcttgaactc
ttctcagccaaggctgccgactccgggacctacatttgccagctaagcaatgatgttggc
acaacaagcagcaaggccaccatctttgtgaaagaacctcctcaatttattaagaagccc
agtccagtgttagtgctgaggaatggacagtcaacaacatttgaatgccaagtcacaggc
acccctgaaatcagagtttcttggtatctggatgggaatgaaataacagatcttaggaaa
tatggcatttcttttgtggatggtttagccactttccagatttctaatgccagggttgaa
aacagtggaacttacgtctgtgaagctcgaaatgatgcaggcaccgcgagctgcagcatt
gaactaaaagtaaaagagcctcccatctttatccgggagctggagcctgtggaagtggta
aaagacagtgatgtggaactggagtgtgaagtcatggggacaactccatttgaagtcact
tggctgaagaataacaaggaaatcagaagtggcaaaaaatacacaatgtctgagaaaatg
tcagtgttttacctgcatataaccaagtgtgacccttcagacgttggtgaatatcagtgc
atcatagccaacgaaggaggcagctgtgcttgtagtgctcgggttgccttgaaagaacca
ccatcgtttatcaagaagatagaaaatgtcaccactgtcttgaagagttccgccaccttt
cagagcaccgtggcaggctcaccgcccatttctataacctggctaaaagatgaccagatt
cttgaggaaaatgacaatgtccatatttcttttgaggacagtgtggccacacttcaagtc
cggagtgtggacaatgggcacagtgggcgatacacatgtcaagccaagaatgagtcagga
attgagaggtgttatgctttcctcttagtacaagaacctgctcaaatcatagagaaagct
aagtcggttgatgttactgagaaagacccagtcaccctggagtgcgtagtggctggaaca
ccagaactcaaagtcaaatggcttaaagatgggaaacaaattgtacccagtagatatttt
tcaatgagttttgaaaataacgtggccagttttaggattcagtcagtcatgaagcaagac
agtggacagtacacgttcaaggtggaaaatgactttggaagcagtagctgtgatgcctac
ctgagagtgctagaccaagatattcccccatcgttcaccaaaaagttaaccaaaatggat
aaagttctgggttcttctatccacatggagtgcaaggtttctgggtcacttcctatcagt
gctcagtggtttaaagatggaaaagagatatctacaagtgcaaaatacagactggtgtgt
cacgaaaacaccgtgtcactggaagttagtaatctggaattagaagacactgcaaattac
acctgcaaggtgtccaatgtagcaggggacaacgcctgtagtggcatcttaactgtgaaa
gaaccaccaagcttcctagtgaaacccgagaggcagcaagctataccggattctaccgtg
gaatttaaggctgtgctgaaaggaacaccaccgttcaaaattaaatggcttaaagatgat
gtggaacttgtctcaggacctaagtgtttcattggcttggaagggtcaaccagcttctta
aacctctactcagtggattcttccaagactggacagtatacttgccaagttaccaatgac
gttggtagcgactcttgcactacaatgttgcttgtgacagaaccaccgaaatttgtaaag
aaattagaagcttccaaaattataaaagcaggtgactctgcacgattggaatgcaagatt
actggatctccagaaatacaagttgtgtggtatagaaacgaacacgagctcacagccagc
gataaataccagatgactttcattgactcggtggcggtcatacagatgaacagccttggg
acagaagacagtggagattttatctgtgaggctcagaatcctgccggcagcaccagctgc
agtaccaaggttatagtaaaagaaccacctgtttttagcagctttccgcctatagtagaa
acccttaagaacactgaagttagccttgaatgtgagctttcaggaacaccgccatttgag
gtggtgtggtacaaagacaagcgccagctccgaagcagcaagaagtacaaggtcgcatct
aagaatttccatgcgagcattcacatcctcaacgtggaatctacagacattggcgaatac
cactgcaaagcacagaatgaagtgggcagtgacgcttgcgtttgcgctgtaaagttaaaa
gaaccaccaaaattcatttccaagctgaacagccttacggtggtagctggcgagcctgct
gagctgcaagcatccatagaaggtgcccagcccatttctgtccagtggcttaaagagaaa
gaagaagtgatcagagagagcgagaacattagaatttctttcgtcaacaacgttgcaact
ctgcagtttgctaaagtggagccagctaatgctgggaagtacatttgccaagtcaagaat
gatggcggagtgagggaaaacatggccacgttgaccgtcttagagcctgcggtcattata
gagaaggcagggtccatgacggtgactgtgggagaaacgtgtgccctggagtgtaaggtg
gctggcactccggagctctctgttgaatggtataaggacggaaagctcttgaccagcagc
caaaaacacaaatttagcttctacaacaaaatctcttccttaaaaatcctctcagttgaa
aaggaagatgcaggcacctacacattccaggttcagaacaacgttggaaaaagcagttgc
acagctgtggtcgatgtgtcagaccgaatggtccctccctctttcacacgaagactgaag
gatactggtggtgtcctgggcacctcttgcatcttagaatgtaaagtagctggatcgtct
cccatctctattgcctggtttcatgagaaaactaagattgtcagtggagcaaagtaccaa
acaacattttcagataatgtctgcacattgcagttgaattctctggactcatcagatatg
ggcagttacacatgtgtggctgctaacgtggctgggtcggatgaatgtcgcgcactgttg
actgtacaagagccaccctcttttgtgaaagaacctgaacccctggaagtccttccgggc
aaaaacataaccttcacaagtgttatcagaggaacccctccattcaaggttggctggttt
aggggagccagagaactggtgaaaggtaacagatgcaatatctattttgaagacactgtg
gcagaactggaattatttaatatcgacatatcccagagtggggaatacacctgcgtggtt
tctaacaatgccggccaagcatcctgcactacacgtctctttgtgaaagaaccagccacg
tttgtaaagaagttaagtgatcactctgtagaaccagggaagtctataattctagagggc
acctatactggaacacttccaatttcggtcacctggaaaaaagacggtgttagcataact
ccatctgaaagatgtaacattgtcaccacggagaaaacgtgcatcctggagattctgagc
agcaccaagggagatgcagggcattactcctgtgagattgaaaacgaggcaggaagagat
gcttgcgacgctcttgtatctacattagaaccaccttattttgttacggagttagaacct
ctggaggcatctgttggagattcagtttccttgcaatgccaagttgctgggacaccagaa
attacagtgtcttggttcaaaggagacaccaaattaaggtcaactccggaatacaggacc
tactttacaaacaacgtggccacacttgtgtttaataaagtgagcatcaatgacagcggg
gagtacacgtgcatggcggagaatagcataggaacagcagcctctaagaccatcttcaga
atccaagagcgccagctcccgccttcctttgcaagacagttaaaggacattgagcaaact
gttggattaccagttaccctcacttgtcgactaaatggctctgcacccatccaagtgtgc
tggtatagagatggggtgcttttaagagatgatgaaaatctacagatgtcatttgtggat
aatgtggcaacattaaaaattttgcaaactgacctgagtcactctggccagtattcttgc
tcagcttccaatccacttggcacagcatcttctactgctagactaacagcaagagaacct
aagaaatcacccttctttgatatcaagccagtatcaatagatgttatcgctggagaaagt
gcagattttgagtgtcatgtgactggtgctcagccaatgagagtcacttggtcaaaagat
aacaaggaaatccgacctggaggaaactatactatcacgtgtgtgggtaacactccccat
ctgaggattcttaaagtgggcaaaggagactctggccaatacacgtgtcaagccaccaat
gacgttggcaaggacatgtgctctgctcagctcagtgtgaaagaacctcctaagtttatt
aagaaattagatgcttcaaaagttgcgaagcagggagaatccatccaactggaatgtaag
ataagtggctccccagagatcaaagttgtgtggttccggaatgacagcgaacttcacgaa
agctggaaatacaacatgtccttcgtgaattctgtggccctgctaaccatcaatgaagcc
agtgctgaggacactggggactacatctgtgaagcccacaatggcgttggtgatgccagc
tgcagcacagccctgaaagttaaagcacctcctgtctttacccagaagcctcctccagtt
ggagccctgaaaggttctgatgtgatcctgcagtgtgaaatttcaggaacaccccccttt
gaggtggtgtgggttaaagatcggaagcaagtgcgaagcagcaagaaatttaaaatcacc
tccaaaaattttgacacgagtcttcatatctttaatctggaagcccctgacataggggaa
tatcactgcaaagccacgaatgaggtgggaagtgacacgtgcgcttgcacggtcaagttc
aaagaaccaccacgatttgtgaaaaaactcagtgatgcgtccacccttattggggatccc
gtggagttacaagccgtggtagaaggtttccagccgatttccgttgtctggctgaaagat
aaaggtgaagtcatcagagagagcgaaaacgttaggatttcctttgttgataacatcgca
actctccaactgggaagtccagaagcatcacagtctggaaaatatgtgtgccaaatcaaa
aacgatgccgggatgcgagagtgttcagcagtcctgactgtcctagaaccagccacaatt
gtagagaaaccagaacccatgactgtcacaactggaaaccccttcacattggagtgtgta
gtagctgggactccagaactttcagccaagtggttcaaagatggtagagaactatcttca
ggcagcagacatcacattacatttgtcagaaacctggcttcccttaagatcccttctgca
gaaatgaatgacaagggcttatataccttcgaggtggaaaacagagttggcaaaagcagc
tgcactgtgtctgtccatgtctcagaccgagttgttccaccgtccttcgtccgaaggctt
aaggacacaagtgccacgctcggagcttctgtggttttggagtgtcgagtgtcgggctca
gcccccatatcagtcggctggtttcttgatggaaatgagatcattagcagtcccaaatgc
cagtccagctttgcagataacgtctgcactctgactctgagctccctggagccctctgac
actggcgcatacacctgtgtggctgccaatgtagccggccaggatgaaagctctgcagtt
ctgactgtccaagaaccaccatcttttgaacaaacccctgactctgtggaagttttgcct
ggaatgagcctgacattcaccagtgtcattagaggcacccctcccttcaaggtcaagtgg
tttaagggcagcagggagctggtgtccggggaggcttgtaccatttctttagaagacttt
gtcactgagttggagctcctggaggtggagccggggcagagtggagattattcttgcctg
gtgaccaatgatgccggcagtgcttcctgtaccacgcatctctttgtgaaagaaccagcc
acttttgtgaaaaggttggctgataccagtgtggagacaggtagccccatcgttctggag
gctacttactctggcacaccacctatctctgtgagctggatgaagaacgaatatcctctt
tcacagtctcccaactgtggcatcaccacaacagaaaaatctagcatcctggaaattctt
gagagcacaatagaggattatgcacagtacgcttgcctgatagaaaatgaagccggacag
gatatctgcgaagctcttgtgtccgtcttggaaccaccttactttatcgaacccctggaa
catgtggaagcagctattggagagcccataactttacagtgtaaagtggatggaacccct
gagatcaggatttcttggtataaggaacatacaaagctacggtcagctcctgcatataag
atgcaattcaaaaacaacgtggcctccttagtcatcaacaaggtggaccacagtgatgtg
ggagagtacacctgcaaggcagaaaacagcgtgggggctgttgcttcttctgccgtgctg
gttatcaaagagcgtaaacttccaccttcctttgcgagaaagctgaaagatgtccacgag
actcttggcttcccagttgcttttgaatgtcgaatcaatggctcagaacctcttcaggtg
tcttggtacaaggatggtgaacttttgaaagacgatgctaatttgcagatgtcttttgtt
catcatgttgccactcttcagattttgcaaactgaccagagccacgttggtcagtataac
tgttcagcttctaatccgcttgggactgcttcgtccagtgctaagctcattctctcagaa
catgaagtgcctcccttctttgacttaaagcctgtgtcagtagaccttgctcttggtgaa
agtggttcttttaaatgtcatgtcactggaacagcaccgatcaaaatcacctgggctaaa
gataaccgtgagattcgccctggaggcaactacaagatgactctggtggaaaatactgcc
actctgacggtgctcaaagtagccaaaggtgatgctggacagtatacctgctacgcgagc
aacgtggctggaaaggactcttgttctgctcaacttggtgtacaagaaccccccaggttc
attaaaaagctagaccaatcacggatcgtgaagcaggatgagtatacaagatacgagtgc
aaaataggcgggtctccagaaatcaaggttttgtggtataaggatgaggtggagattcaa
gaaagcagtaaattccggatgtcattcgaggactcggtggccatcctggagatgcacagt
ctcagtgtggaagacagcggggactacacctgtgaggctcgcaacgcagcagggagcgcc
agcagcagcacctccctgaaggttaaagaaccacccgtgttccgcaaaaagccttttccg
gttgagacacttaaaggagccgatgttcaccttgagtgtgagcttcaggggacacctccc
tttcaagtttcttggcacaaagacaagcgagaacttaggagtgggaagaagtacaagatt
atgtctgagaatttgctcacgagcatccacatcctgaacgtagacacggcagacattggg
gaataccagtgcaaagccacaaacgatgttgggagtgatacctgtgtgggctctgtcact
atgaaagcaccaccacaatttgtgaagaagctcaccgacatttctaccatcattggcaaa
gaagtccagctgcagacaacaattgaaggcgctgagccaatttcagtggcgtggttcaaa
gacaaaggggaaattgttagagagagtgacaacatatggatttcttactctgaaaacatc
gccaccctccagttttcaagagcagaaccagccaatgctgggaaatacacctgccagatc
aaaaacgatgctgggatgcaggagtgctacgccacgctatcagtgctcgagcctgctgca
attgtggaaaagccagaatctattaaggtgaccacaggagacacctgtaccttggagtgc
acggtatcaggaacacctgagcttagtaccaagtggtttaaggacggaaaggagctcacg
agtgacaacaaatataaaataagcttcttcaacaaggtgtctggcctcaagatcatcaat
gtggtgcctggcgacagtggggtgtacagctttgaagtgcaaaaccctgtcggcaaagac
agctgcaaagtctccattcaagtctcagatcgaatcatccctccctcgttcacaagaaaa
ctgaaagagacgaacggtctgtcgggctcctccgtggtgatggagtgcaaagtgtacgga
tcacccccaatctctgtcctgtggttccatgacgggaatgagatcagcagtggccggaag
taccagaccacactgacagacaacacgtgtgccctgacggtgaacatgctggaggaagct
gacgccggcgactatacatgtatagctaccaatgtggcaggctccgacgagtgtagtgcc
cctctgactgtacgagagccaccatcttttgttcagaaacctgacccgatggatgtctta
actggcagtaatgtcacgttcacaagcattgtcaaaggctcacctcctttcactgtcagc
tggttcaaaggtagcactgagcttgtgcctggggccaggtgcaacgtgtctctgcaggac
tcggtgggtgaactggagctgtttgacgtggatacgtcccagagcggagaatacacctgc
atagttagtaacgaggctggcagggcttcctgcacaacacgtctcttcgtaaaagcccca
gccatatttgtgaagcgactcaatgactacagcatagagaaaggcaagcctctgatcctt
gaagggaccttctctggaactcctccgatctctgttacatggaagaaaaatggcataaat
gtcatagcttcccaacggtgtaatattaccacaactgaaaaatcagccatcctagaaatt
ctgagcagcactgtcgaagattcagggcagtacaactgctacattgaaaacgcttctggc
aaggactcctgctcggcccagatcctgattctagaaccaccgtattttgtcaagcagttg
gagcctgtgaaggtgacggttggtgactctgcctctctacaatgccagcttgctggaact
cccgagattggggtctcctggtataaaggagacacaaagctcaggcccactgccacctgc
aaaatgcattttaagaacaacgttgcgacactggttttcacccaggttgatagcagcgac
agcggagaatatatctgcagggctgagaacagtgtaggcgaggtttcttcatcaactttc
ctgactgttcaagagcaaaaacttccaccatccttttctcgacaactaagagatgtgcaa
gagaccgtgggattgccagtggtttttgaatgtgctgtaagtgggtccgagcccatctct
gtgtcttggtacaaagatggcaagccgttgaaagacagcccaaatatacaaacatcattt
ttagacaacatcgccactctgaacatctttaagacagacaggagtctctcgggccagtac
tcttgcactgctacaaaccccattggctctgcttcttcaggcgccaaactcatcctcaca
gaggggaagaacccacccttctttgatatccctctggcccctatggatgctgttgtggga
gaaagtgctgacctggaatgccatgtcacgggaacacagcccattaaggtaacctgggcc
aaggacaacagagagatacgaagtggtggaaactaccagatcagctatctggaaaacagt
gcccacctgaccatcgtgaaagtggacaaaggtgactctggccagtacacctgctacgcc
gtcaatgaagtgggaaaagactcctgcacagcccaactcaatataaaagagcgcctcatc
ccaccgagtttcaccaaaaaactatctgagacggtagaagagacagaagggaactcattc
aaactggaagggcgtgtggcagggtcccagcccatcaccgttgcttggtacaaaaataat
gtagagatccacccgacctccaactgtgagatcatgttcaagaacaacgcactgctgctg
caggtgaagagggccagcatggccgatgcaggcttatacacctgcaaggcgacaaatgac
gcaggctctgccctgtgcacatcgtccattgtcatcaaagagcctaagaagccgcctgtg
tttgaccagcaccttgccccggtcacggccagcgaaggtgactctgtacagctcagctgc
cacgtgcagggctccgagcccattcggatccagtggttgaaagctggtagggaggtaaag
ccttcggacaggtgcagcttcagctttgctagcggaaccgccatgctggaactcaaggag
acagctaaagcagattcaggagactacgtgtgtaaggcttccaacgtggctggaagtgac
acttcaaagtgcaaagtgaccattaaagagaaaccagccgcagccccagcagccaagaaa
gcagccgtggatggaaaactcttcttcgtgtcagagcctcagagcatcagagtagtggaa
aaaaccactgccacgtttattgcaaaagttggaggtgacccgatcccgaatgtcaaatgg
acaaaagggaagtggagacagctgaaccaagggggtcgcattcttatccatcaaaagggc
gacgaagcgaagctggagattcgtgacaccacaaaaaccgattctggcttataccgttgc
gttgcctttaacaagcacggtgaaattgaaagcaatgtcaacctacaggtggatgaaaga
aagaaacaagagaagattgaaggtgatcttcgcgcgatgctgaaaaagactccagccctc
aagaaaggatctggggaagaagaggaaattgatatcatggaacttctcaaaaatgtggat
cctaaagagtatgagaagtatgcgcgcatgtacggaatcaccgacttccggggcctcctc
caagcgtttgagctgctgaaacagagccaggaagaagagactcacagactggaaatcgag
gaactagagaagtcagaaagagatgaaaaggaattcgaagaacttgtagcatttattcag
caaaggctgacacagacagagcctgtcactttgatcaaggatattgaaaatcagacagtt
ctgaaagataatgacgccatctttgaaattgacattaagattaattatccagaaatcaag
ctttcctggtacaaagggactgaaaagctggagcccagtaacaaatatgaaataagcatc
gatggtgaccggcacacactcagagtcaaaaactgtcagcctaaagatcagggcaattac
cgtctggtctgtggtccccacatcgctagtgccaagctaactgtgattgagcccgcctgg
gagcggcatctccaggacgttactctgaaggaaggccagacttgtaccatgacgtgtcag
ttttctgtaccaaatgtgaaatctgagtggttcagaaatggcagagtccttaaacctcaa
ggcagagtgaaaacggaagtggaacacaaagtccacaagctgaccattgccgatgtccgt
gcagaggaccagggtcagtacacctgcaagcacgaagacctcgaaacttcagcagagctc
agaatcgaagccgaacccattcagtttacaaagcgcatacagaacatcgtggtgagcgag
catcagtctgctactttcgagtgcgaagtgtcctttgacgacgccatagttacctggtac
aaaggaccaacagagctgactgagagccagaaatacaactttagaaacgacggccgctgc
cattacatgacaatccacaatgtgaccccagatgacgaaggtgtctattcagtaattgct
cggctggagccaagaggcgaagcaagaagcacagcggaactgtacttaacaaccaaagaa
ataaaacttgagatgaagcctcctgatattcccgattccagagttccaatcccaaccatg
cccatcagagctgtcccaccggaagaaatccctcctgcggttgctccttccatccctctt
ttgctgccattacctgaagagaagaagccgccagcaaaacgaattgaagtgaccaaaaag
ggtgtgaaaaaagataccaaaaaagttgtcacaaagcccaaagaagaggccccaccacca
ccagtcccagaagttgccaagaagcctccacctcctactcccatgattccagcaaaagct
tctgagattattgacgtgtcctctaaggctgaagaggtaaaaataacaaccatcaccaga
aagaaagaggttcacaaagagaaagaggctgtgtatgaacgagaggaagcagtctacgaa
aagaaagttcacatagagccttgggaagagccctatgaggaattggaaacggaaccatac
acagagccatatgaagaaccctattatgaagaaccagatgaagactatgaagagatcaag
gtggaagctaaaaagcaagtccacgaggaatgggaggaggactttgaagaaggacaggag
tactatgagagagaagagggctacgatgaaggggaggaagagtgggaagagatttaccat
gaaagagaaataattcaggttcagaaggaggttcatgaagaattacatgagaagaaaatc
ccagccaaagtgcctgaaaagaaagtaccacctcccaaagttgtaaagaagccagtagtt
gaaaaagttgaaaagactactcggagaatggaggaagaaaaagttcaagtcatcaaagta
cctgaagtttctaagaagattgttccacaaaaaccttcccggactccagtgcaggaagaa
ataattgaagtgaaagtaccagctgtgcacacaaagaagatggttatctctgaagaaaag
atgttctttgcttctcacacagaggaagaggtgtctgtctcagtccccgaggtgcaaaag
aaaactgtcactgaagagaaaattcacgttgcagtttccaaaaagattgaaccaccaccc
aaagtccctgaaccacctaaaaagccagttccagaagaagtggtccctgttcccattcct
aagaaggtggaacccccagcagccaaagttcctgaggctcccaagaaacctgtgccagag
gagaaaaagccagttcctattcccaagaagaaagagccagctgcccctccacaagtccca
gaggctccaaagaaacctgctcccgaagaaaagattcctgttcctgtgacaaagaagaag
gaagcccctccagctaaagttcctgaagtgcagaagaaggttgtcacagaagaaaaaata
gccatcattactcaaagagaggagtcccctccaccagcagtaccagaaataccaaagaag
aaagttcccgaagaaaaaagacctgttcctagaaaagaggaagtccccccaccaaaagtg
ccagtgccacctaagaaagctgttcctgaggcggttgttccagctcccatccctaagaaa
gctcctccccgagctgaagtttctaagaaaactgttgtagaagagaaaagatttgctgct
gaagaaaaactatcggtggcagttcctcagagagtggaactcatgcggcacgaagaggag
gaatggacttactctgaagaagaggaaagagtgtctgtttcggtgtatagggaagaggaa
agagatgaggaggaagcagaaatcacagagtatgaagtgttggaagagcccgaggaatat
gttgtggaagaaaagatgcactttatctctaagaaagtggaagttgaaccagccaaagtg
cctgagaagaaaattataccaaaaccaaaagttcctgctaaaattgaggagcctccaccc
actaaagttcccgaaccaccaaagaaaattgtaccagagaagaaagttcctgcaccagct
cccaaaaaggtgccgccagccaaagcccctgaagaatcaaagagaccagttcccgagaag
agggctcctgcagaagaggttgggatagaagaacctcccccaaccaaagtggccgaaagg
cacatgaaaattacccaggaagaaaaagttcttgtggctgtaactaaaaaggaggcgcct
ccgagagcgagagtgccagaggaacctaagaaagttgcccctgaagaaagatttcccaag
ctcaaacctcgaagagaggaggagccaccagctaaagtgaccgaagttagaaaaagagct
gttaaagaagaaaaggtgtccattgaagttccaaagagagaaccccgacccactaaagaa
gtgactgtgacagaagagaagaaatggtcttacacccgagaagaagaaactgtttcagaa
catcgggaggaggagtatgaggattacgaagactatgaggagtataaagagtttgaggag
tacgaacccaccgaagaatatgaccagtatgacgagtatgcagagcgtgaggtggagcac
tatgaagagcatgaggaatacgtcacagaacccaagaagcctgtcccagtgaaacctgcc
caagaaccggtgcctgctaaacccaaggctcccccaccaaaagtgctaaagaaagctgtc
cctgaagaaaaagcacccctgcccattcaaaagaaactcaaacctctgccacccaaagct
cccgaagaaccaaagaaagttgttgaagaaaaaatacagatttcaattaccaaacgtgaa
aagcagcaggtgactgaaccggtcgccaaagtgcctatgaagcccaagagagttgtccca
gaggcaaaaatacctgcccctacaaaggaagtggcagtgcctgttagagtgccaggggta
cccaaaaaacgagaactggaagaggttgttgtcttcaaagaggaggtggaagcccatgaa
gaatacattgtagaggaagaagaggaatatgtccatgaagaggagtatgtccacaaagaa
gaatatgtccatgaagaagagtacgtccataaagaggaatatatccacgaagaggaagaa
caccttcatgaagaggaggagaccatagctgaggaagaggtggtgcctgtggccccagtc
aaagtgcctgtggtacccaagaaacctgttccagaagagaaaaaacctgttcctgttccc
aaaaagaaggaagcaccaccagccaaagtgcctgagattcccaagaagccagaggaaaaa
gttcctgtgcctattcctaaaaaggagaaggctccacctgccaaagtcccggaagtgccc
aagaagcctgtaccagaggagaagccaccagtacctgttcccaaaaaggtggaaccacca
ccagccaaagtgccagaagtgccgaagaaacctgtgcctgagaagaaggtaccagcgcct
actcctaagaaagtagaggctcctcctgcaaaagtgccagaggtgcccaagaaacccatt
ccagaagaaaagaaaccaacagctcttctgaaaaaaatggaagccccacccccgaaagcg
ccaaagaaacgggaggtagtcccagttcctgtggctctacctcgggaagaagaagaagaa
gaagtgccatttgaggaagttcctgaagaggaaattctacctgaggaagaagttccatct
gaggaggaagctccacctgaagaagttccaccagaggaagaggaagttcttcctgaagaa
gaggaagttcttcctgaagaagaggaagttcttcctgaggaagaggaagttcaacctgag
gaagaagctcttccagagattaaacctaaggtgccaaaacctgcaccagtgccaaagaaa
actgtccctgagaagaaagtccccgttcctgttcctaaaaaagtggagcctccaccacct
cccaaagtgcctgagatcaagaagaaagtgccagagaagaaagtagttgttcccaagaaa
gaggaggctcctcccaccaaagttcctgtggttcctaagaagcctgaaccagaaaagaag
gtgcctgtccctgcccttaagaaagcagtggtccctcctgccaaagttcctgaggtgtct
aagaaggtggaagaaagacggatcatcccccctaaagaagaggaagttccaccagctgaa
gtatatgaggaggctgaagaacccactccagaagagattccagaagagccgcctagcata
gaagaagaagagatagtggaggaagaggaggaggaggaggaggtgctgccacctagagca
cctgaagtggtgaagaaagcagtacccgaagctcccactcctgtccctaagaaagcggag
gcaccccccgcaaaagtgccaaagaaaatccctgaggaaaaggttcccgtgccggtccag
aaaaaagaggccccaccagccaaagtgcctgaagtgccaaagaaagtcccagaaaagaag
aaaatccctgaaaagaaagtccctgtgcccaaaaaggaagctgttccaccggctaaaggg
aaagctgtttttgaagaaaaaatatcagttgcctaccagcaagaagaactagtccaagaa
agaatagagctagaactcgtggaagccaaagtggaagaggctttcgaagaagaggagttc
cacgaggtgcaggaatactttgaggaagaggagttccacgaggtggaggagttcatcagg
gtggaagagcgcaggttccaagaagagcacaaagtggaagaagtccacagggtcattgag
ttcctagaggctgaagaagtggaagtatacgaaaagcccaaaattccacctaaaaaagga
cctgaggtatctgagaaagtcatccctccaaaaaagccacccactaaagtcattcctcga
aaagagccaccagctaaagtacctgaggtgaccaagaaaacggtggttgaagaaaaaatc
cgtgctcctgaagaaccgaaggtgccggcacctaaagcacccgaagtaccaaagaaaatc
actccagaagaaaaagtccgtgaagctgttcctaaaaagcctgaagttccaccacctaaa
gttcctgaggtgcctaagaaaattattcaagaagaaaaattacccgttgttcttcctgaa
gacacagagatatacatgtatgaagcatctgaagagacagtcatagaagaagagcatgtc
actcttccgcagaaggcaagactcaaagtggcaaaagtgcctgcaccaccccaaacagtt
gttacagaagagaaaacttatgtgaccattcgtaaaacgagggaaaccctggcactcaaa
gagtctgaaacaacccgggaagcgtttccagagctgaagtcatataaggctgtccctgaa
attcctgagcctccttcacctgaagaccttgaaatcattgaagatgtgcttccggagaag
cgacctcctgcatccaaaagaagaaaaactcaactcccgacagcaccagaagctccgaga
gagatgcctcctgaaatgaacacctttgaagaaatttctgtagagccagaaatgctgccc
acccaagaacctgaagcccccactgaagttgatgttgcaaagagagccccttcaaaaccc
agaggcgctcccgcagttacagtgctggacacttaccaagaagccacggtggagaagaaa
acacttcggatttctcgcaaaaagcctgagcttccttcagatgaagaagtgcccgaggct
cccagagaagttgtggccaaaaagaaagtgctccctccccaagtgccggaagttgtacct
gtgaaagtgcctggggctcctaaagaggttgtctctgaaaggaaatcgcttgaggaacca
cctaaaaagccagcagtccggccagtcacagtgcccgaggagcccaaagaggtcatccct
gaaaagaaagtgtccctggtgcctcctaaaaagccagcagccccacctgtcacagtgcct
gaggcacctgaagaggtcttctctgaagacgaagagaccctggcaccccctcaagagcca
gaggccccacctgccaaagtgccagaggctcccaaagaagttgttcctgaaaagaaagtc
tccgtggtgcctcccaaaaagccagaagccccacctgccaaagtgccagaggcacccaag
gaagctgcccctgagaagaaagtgccagtggcacctaagaaaaagccagaagccccaccc
gtgaaagtgccagaggcacccaagaaagttgtccctgagaagaaactgccagtagcagct
cctaaaaagcctgaagccccagctgctgaagtacccgaggtgccaaagacagctgttccc
caaaagaagatccctgaggccattccccccaaaccggaaagtcctccccttgaagtgcct
gaagtaccacccaaggaagtcactcctgaaaagaaagttccagcagcacctcccacgaag
ccagaaattccacctcccaaagtacctgaagctcctcaggcagctgttgttgaagagaaa
acccctgaggcactgcccaaaaaggcggaagccgcccctgtcccagtgcctcaagtccaa
gagactgtccctgaaaagacaagaccagtgggacctcctaaaaagccagaagccacaact
gtcccagtgcccaaagtccagaaaactatccctgaaaagacaagaccagaggcccctcct
aaaaggccagaagccaggactgtcccagtgcctcaagtccaagagactgtcccagaaaag
acaagaccgatggctcctcctaaaaagccagaagccacaactctcccagtgcctgaagtc
caagagactgtccctgaaaagacaagaccagtgggacctcctaagaagccagaagccaca
actgtcccagtgcctgaagtccaagaaactatcccagaaaagacaagacctcctaaaaag
ccagaagccacacctgtcccagtgcctgaagtccaagagactgtccctgaaaagacaaga
ccagtaggacctcctaagaagccagaagccacaactgtctcagtacctgaagtccaagaa
actatccctgaaaagacaagaccagcggcccctcctaaaaagccagaagccacagctgtc
ccagtgcccaaagtccaagaaactatccctgaaaagacaagaccagaggcccctcctaaa
aggccagaagccacaactgtcccagtgcctgaagctgatcaagcagttgtcccagaaaag
aaagtccccagggtcccgcccaaaaaagttgaagccccacctattacagtgcctgaggaa
cctaaagaggtcatccctgaaaagaaagtgtccctggtgcctcctaaaaagccagcagcc
ccacctgtcacagtgcctgaggcacctgaagaggtcttctctgaagacgaagagaccctg
gcaccccctcaagagccagaggccccacctgccaaagtgccagaggctcccaaagaagtt
gttcctgaaaagaaagtctccgtggtgcctcccaaaaagccagaagccccacctgccaaa
gtgccagaggcacccaaggaagctgcccctgagaagaaagtgccagtggcacctaagaaa
aagccagaagccccacccgtgaaagtgccagaggcacccaagaaagttgtccctgagaag
aaactgccagtagcagctcctaaaaagcctgaagccccagctgctgaagtacccgaggtg
ccaaaggcagctgttccccaaaagaagatccctgaggccattcctcccaaaccagagagt
cctccccctgaagtgtatgaggaacctgaagaggagattgtcccagaagagcctccagag
gaggctgtggaagaaccagtgccagctccccctccaaaagtgacagagccacctaagaag
cctgtccctgagaagaaagcgcctcctgctgttgtcaagaaacctgaacccccaccagcg
aaagtgcctgaagtgcctaaggaagctccccctgaaaagaaagtgcctcccaaaaagcca
gaagccccacctgctaaagtgccagaagttccgaaagaagttgtcacagaaaagaaagtg
gctgttcccaaaaagccagaagtcccgccagccaaagtgccagaggtgccaaagaaacct
gtcattgaagagaagccagccattcctgttgttgagaaagtggcgtcccctcctgctgaa
gtatatgaagaaccggaagaagtcactgctgaggaagaggagccagcccctgctgtagaa
gaggaggaatacgaagctccccctccccctgcaccagtgcctgaagagcctaagaaggtt
gtcccagagaagaaatttcctgtcatcaaaaaaccagaggctccccctcctaaagtacct
gaggtgccaaagaaagctgtgcccgtgaagaaagttccggttgttaagaagccagaacca
ccagaagctgaagtccccgaggtgccgaagaaacttgttccagtcaagaaggaacctgtg
cctgttaccaaaaaaacagaagtcctgccagaaaaagtaccggaagcacccaagaaaatt
accccagaaaagaaagagtctgttcccgtgcctgaagagccagaggcccctcctgcctca
gtggaagagactcctgaggagacaatctatgaagagaaagcaaccattaccattggtaga
aaagagacgccccctgttgaagaacgcgaaattgaaaagtttattcaacctgaagaaccc
gaactggaaccagagccagaagaaatcccagtacaagaacctgagccagagaagaaggtt
atcgagaaaccaaaactcaaaccaagaccccctgcacgtcctccttctccacctaaggaa
gatgtgaaggagaaaatgttccaacttaaagctgtttcaaagaagaaagttcctgaaaaa
cccgaggttgtggaaaaagtggagcctgcaccactaaaagtgcctacagctgaaaagaaa
gttcgtaaattacttcctgaacctaagccgcagccaaaggaagaggtggtgctgaaaagc
gttctaagaaagaaacccgaggaagaagaacctaaagtagaacctaaaaaagtagaaaaa
gctaaaaaaccggaagagccacagccacctccaaaagccgttgaagttgaagctcctcca
gagcctacaccaaaggaaaggaaagttccagaaccggccaaagttcctgaaattaagcca
gcgatacctctccctggacctgaaccaaagccaaagcctgagccagaggtgaaaaccatg
aaagctccacccatcgagccggcacccactcccatcgctgcccccgtgacagcgcctgtg
gttgggaagaaagcagaagccaaacctaaggatgaggctgccaagccaaaaggtcccatc
aaaggtgtagccaaaaagactccttcaccaatagaagctgaaaggaaaaagctcagacca
ggaagcggtggagagaaacctccagacgaagctccgttcacttaccaactcaaggccgtg
ccactgaaattcgtgaaagaaatcaaagacatcgttttgacagaggcagagtctgtgggc
tcttctgccatcttcgaatgtttggtctccccatccactgccattacaacctggatgaag
gacggcagcaacatccgtgagagcccaaagcacagattcattgcagacggcaaagacagg
aagctgcacattatcgacgttcagctgtctgatgctggtgaatacacctgtgtgctacgc
ttgggaaataaagagaagacgtccactgctaagctcatcgtagaagaacttcctgtgcgc
tttgtgaaaacactggaggaggaagtcacggtggtcaaggggcagccgttgtacttgagc
tgtgagttgaacaaagaacgcgatgtggtctggaggaaggatggtaagattgtggtggag
aaacctggcaggatcgtgcctggtgtcattggcctgatgcgggccctgaccatcaatgat
gctgatgacactgatgccggaacatacactgtgactgtggaaaatgccaacaacctggaa
tgttcttcttgtgtaaaagtagtagaaatcattagagaatggcttgtgaaacctatccga
gatcagcatgtgaagcccaagggaacagctgttttcacctgtgacatagccaaggacacg
ccaaacattaagtggttcaaaggctatgacgagatccccttggaaccaaacgacaagact
gagatactgaaagagggaaaccacctctttctcaaggttaagaatgctatgccagaagat
attgatgagtatgcagtggaaattgaagggaaaagatacccagcaaagctgacacttgga
gagcgcgaagttgagctacttaagccgatagaagatgtcaccatttatgagaaggaaagt
gccagctttgatgcagaaatctcagaggaagacattcctggggagtggaagctgaagggc
gagcttctgcggccctcgcctacttgtgaaatcaaagctgaaggtgggaagcgcttctta
actttgcacaaagtgaaactggaccaagctggcgaagtcctctaccaggcttgcaatgcg
atcacaactgccattctgacagtcaaagaaatcgagcttgactttgctgtacccctgaag
gatgtgactgtcccagagaagagacaggctcggtttgaatgtgtcctcaccagagaggca
aatgtcatatggtctaaagggcctgatataatcaaggcatctgacaaatttgatattatt
gctgatggaaagaaacacattcttgttatcaacgactctcagtttgacgatgaaggagtc
tatactgcagaggtggagggcaagaagacgtcagcacaattatttgtgacaggcataaga
cttaagttcatatcaccactggaagatcaaacagtaaaagaaggccaaacagcaactttt
gtctgtgagctctctcatgaaaaaatgcacgtggtctggttcaaaaacgatgtcaagcta
cacacaaccaggacagtgctcatgtcttctgagggaaagacttataagctggagataagg
gagaccacactggatgatatctcacagatcaaagctcaagtgaagaacctcagctctaca
gccaacctgaaggtcttggaggccgatccctacttcaccgtgaaattacacgacaagact
ggcgtggagaaggacgagatcattcttaagtgtgaagtgagcaaagatgttccggtcaaa
tggttcaaagacggggaagagattgtgccttcgcccaaacattctgtcaagaccgacggc
ctgcgccgcatcttaaagatcaagaaggcagagctcaaagacaaaggggaatatgtgtgc
gactgcggtacagacaccaccaaggccaacgtcactgttgaggctcgactcataaaagtg
gagaaacccctgtacggcgtggaagtgtttgtgggtgaaaccgcccgctttgaaattgaa
ctgtctgaacctgacgtgcatggccagtggaagttaaagggagagcctttgactgcttct
cctgactgcgaaatcatcgaagatgggaagaaacatgtcttggttctgtataactgtcag
ctggatatgaccggggagatatccttccaggccgccaacgctaaatcagcagccaacctg
aaagtgaaagaactgccgctcattttcatcacccctctgagtgacgtcaaagtctttgag
aaagatgaggcgaagtttgagtgtgaagtatccagggagcccaaaacattccgctggctg
aaaggaacccaggaaatcactggtgatgacagatttgagctcatcaaggatggcaccagg
cattcattggtgatcaagtcagcagcttttgaagatgaggccaaatacatgtttgaagct
gaagataaacgcacaagcggcaaactgatcattgaaggaatccgtctcaaattcctgacc
ccactcaaggatgtgacagccaaagaaagggaaaatgccgtgtttactgtggagctgtcc
catgacaacatcccagtgagctggttcaagaacgaccagcgcctgcacaccagcaagcgg
gtctccatgcatgatgaagggaaaacacactccatcacgttcaaagacctgtctattgac
gacacctcccaaattagagtggaggccatggggataagttcagaggctaagctcactgtg
ctggagggagacccatacttcacaggaaagcttcaagattacacaggcgtggagaaggat
gaagtgattcttcagtgtgaaatcagcaaagcagacgcacccgtgaaatggtttaaggac
gggaaggaaattaagccgtctaaaaacgttgttatcaaggctgacggcaagaaacgcatg
ctgatcctgaagaaggccttgaaatcagatatcggccaatatacctgtgactgtgggaca
gaccagacctctgggaagctggacattgaagatcgggaaattaaactggtgcgacccctg
tacagcgtggaggtgatggagaccgagacggcccgctttgaaactgagatctctgaagat
gatatacatgccaactggaaactgaagggagaggcactgctccaaacacctgaatgtgaa
attaaagaagaaggcaagatccacgtccttatcttacacaactgccgcctagaccagact
ggaggtgtagatttccaagctgccaatgtcaaatctagtgcccacctccgagttaaacca
cgggtaattggtctgctgaggcctctaaaggatgttacagtgaccgcaggggaaacggcc
acctttgactgcgagctctcctatgaggatatcccagtggaatggtacctcaaagggaag
aagctggagcctaacgataaggtggtgacacgttcagaaggaagagttcacacgctcacc
ctgagggatgtgaagctagaagatgctggcgaagtccaactaactgcaaaggatttcaaa
actcaggccaatctctttgtgaaagaacccccggttgagttcactaagcctcttgaggac
cagacggtcgaagaggaggccactgcagtactggagtgtgaagtatccagagaaaatgcc
aaagtgaaatggttcaaaaatgggacagaaatcctcaaaagcaagaagtatgaaatcgtt
gctgatggcagggtcaggaagctcattattcatggttgtaccccagaggatatcaaaacg
tacacttgtgatgctaaagattttaagacctcctgtaacctgaatgttgttcctcctcat
gtggaattcttaagaccactcacagacctccaagtcaaagaaaaagaaactgctcggttc
gagtgcgaaatttccaaagaaaatgagaaggttcagtggtttaaagatggtgctgaaatt
aaaaagggcaaaaagtatgacatcatttctaagggagcagtacgaattcttgtcatcaac
aaatgtctactgaatgatgaagcagaatattcctgtgaagtgaggacagcaagaacttcc
ggcatgctgacagtcctagaagaagaagctgtcttcacaaaaaatcttgccaaccttgaa
gttagtgaaggagacactatcaaactggtgtgtgaagtctccaagcctggggcagaagtg
atttggtacaaaggggatgaggagatcatcgaaacagggagatttgaaatacttactgat
ggaaggaagagaatcttgatcattcagaatgcgcagcttgaggatgcaggcagctacaac
tgtcgactcccaagttctcgaacggacagcaaagtcaaagtacacgaacttgctgctgag
ttcatctcgaagcctcaaaaccttgaaattcttgaaggagaaaaggctgagtttgtctgc
actatctcaaaggaaagcttcgaagttcagtggaagagggatgatcagacacttgaatct
ggagataaatatgacatcattgctgatggcaaaaagagagtcctagttgtaaaggatgcc
acattacaagacatgggcacttacgtagtcatggttggggctgccagagccgcagctcac
ctgacagtcattgaaaaactcaggatcatagttcctcttaaggacaccaaggtgaaggaa
caacaagaggttgtcttcaactgcgaagtcaatactgaaggtgccaaagccaaatggttc
agaaatgaagaagccatatttgatagttcaaaatacatcattctccaaaaagacctggtc
tacaccctcagaatcagagatgcacggttagatgaccaagccaactttaatgtgtctttg
accaatcacagaggtgaaaatgttaaaagtgcagccaatctaatagtggaagaggaagat
cttaggattgttgaacctcttaaagatattgaaacaatggagaagaagtcagtcacattc
tggtgcaaggtgaatcgtctcaatgtgacactgaagtggaccaaaaatggagaagaagtg
gcttttgacaaccgtatatcataccgaattgataagtacaaacactctctaatcatcaag
gactgtggcttcccagatgaaggtgaatacgtcgtcactgctgggcaagataaatccgtg
gcagagctgctcatcatagaagccccaacagaattcgtggagcacctggaagaccagacg
gtcacagagtttgatgacgctgtcttctcctgccagctctccagagagaaagcgaatgta
aaatggtacagaaatggaagagaaatcaaggaaggcaaaaaatacaagtttgagaaggat
gggagcatccacaggctcatcataaaagactgcaggctggaggatgagtgtgaatacgct
tgtggtgtagaggaccgcaagtcccgagctagactttttgtagaagaaattccagttgag
attatcaggcctcctcaagacattcttgaagcccctggtgcagacgttatcttcttggct
gagctcaacaaagataaagtggaggtccaatggcttagaaataacatgatcgtcgtccag
ggtgacaagcaccagatgatgagtgaaggaaagatacacaggctacagatttgtgatatt
aagccacgtgaccagggcgaatacagattcattgccaaagataaagaagccagggctaaa
cttgaattagcagctgcacctaaaatcaagacagctgatcaagatctcgtcgttgatgct
ggccagcctctgacaatggtggtaccctatgatgcctaccccaaagcagaagctgaatgg
tttaaagagaacgaacctctatctacaaaaaccgttgacactacggctgagcagacttct
ttcagaatctcagaagccaagaaggacgacaaggggaggtataaaatcgtgcttcagaac
aagcatgggaaagcagagggcttcatcaatttacaagttattgatgttcccgggccagtt
cgtaacttagaagtgacagaaacatttgatggtgaagtaagcctcgcctgggaggaacca
ctaacggatggtgggagcaaaatcataggctatgttgttgaaaggcgtgatatcaagaga
aagacctgggttctggtcactgaccgagcggacagctgtgagttcactgtcactggacta
cagaaaggaggagtggagtacctgttccgtgtgagtgcaaggaacagagttggcactgga
gaacccgtagaaactgacagtcctgtagaagcaaggagtaaatatgatgttccaggccct
cctttgaatgtaaccatcaccgatgtgaatagatttggtgtctcactaacatgggagcca
ccagagtacgatggaggtgctgaaatcacaaactatgtgattgagctgagagacaagact
tctatcagatgggacactgccatgaccgtaagagctgaagacctgtcagcaactgtcact
gatgtggttgaaggacaggagtatagtttccgtgtcagagcccagaaccgaatcggagtt
gggaaaccaagtgcagccacaccctttgtcaaagttgctgatccaatagagagaccaagt
cctcctgtgaacctaaacgcctcagaacagacacagtcatcagttcagctcacctgggag
cctcctctgaaagatggaggcagccccatactgggctacataattgaaagacgtgaagag
ggaaaagacaattggattcgctgcaatatgaaacctgtccctgaactgacttacaaggtc
actggattgcaaaaagggaacaaatatttatatagagtgtctgcagaaaatgcagctggt
gtttcagatccatctgagatcctcggtcctctcactgctgatgatgcgtttgttgaacca
acgatggatttaagtgcattcaaagatggtttggaagtcatagttcccaatcccatcaag
atcctggtcccaagcacaggctatccaagaccaaaagcaacctggacttttggagatcaa
gtacttgaagagggggatcgtgtgaaaatgaagaccatatcagcctatgccgagcttgtc
atttctccaagcgaacgaacagacaaaggcatttacacactcacgttagaaaatcctgtg
aagtcaatttctggagaaatcaatgtcaatgtaattgctcctccaagtgcgcccaaagaa
ctgaaatttagtgatataacaaaggattctgtacatttgacttgggaaccaccagatgat
gatggagggagtccactaactggatatgttgttgaaaagagagacatgagccggaaaaca
tggactaaagttatggactttgttactgatctagaattcacagttcctgatcttgttcaa
ggaaaggagtatctattcaaagtctgtgcccgaaataagtgtggccctggagaacctgca
tatactgatgaacctgtaaatatgtctgcccctgcaacggtacctgacccaccagagaat
gttaaatggagagacaggacagccaacagcatcttcctaacatgggatcctcctaaaaat
gatggtggctctcgtatcaaaggatatatagttgaaaaatgtccacgtggttctgataaa
tgggttgcctgtggagaacctgttccagatacaaaaatggaagtgacaggtcttgaggaa
ggcaaatggtatgcctaccgtgtgaaggccttgaacaggcaaggtgctagcaagccaagc
aaacccactgaagagatccaggcggtggacacacaggaggcccctgagatcttcctggat
gtgaagctcctggctgggatcactgtgaaagctggaacgaagatcgaacttcccgccacg
gtgactggaaaaccggaaccgaaaataacttggaccaaggctgacacccttctgaagcca
gaccagagaatcaccattgaaaacgttcctaaaaaatccacagtgacaatcacagacagt
aagagaagtgacacaggcacatatatcatagaagccgtgaacgtctgtggccgggccact
gctgtggtagaagtgaatgtcttagataaacctggaccaccagctgcctttgacatcaca
gatgtaaccaatgagtcgtgtcttctgacctggaacccaccaagagacgatggcgggtct
aagatcacaaactatgtggtggagagaaaagcaacagacagtgatgtgtggcataagctc
tcatcaaccgttaaggacacaaacttcaaggcaaccaaattaacacccaacaaagagtac
atcttcagagttgctgcagaaaatatgtatggtgttggtgagccggttcaagctgctcca
ataatagccaaataccagtttgatccacccggacctccaactcgcctagaaccttccgac
atcactaaagatgcggtgacgctcacatggtgtgagccagatgatgatggtggcagtccc
atcactggatactgggttgaaagattagatcctgacactgataaatgggttcgatgcaat
aagatgccagtgaaggacacaacatacagggtaaaaggtctcaccaataagaaaaagtac
agattccgcgtgcttgctgaaaatttggcagggccaggaaaaccaagtagatcaactgaa
ccaatcttaataaaggatcccatagatcctccatggccccctggaaaaccaactgtaaag
gatataggcaaaacctccttagtattgaactggaccaagccagaacacgatggaggggca
aagattgagtcttacgtcattgagatgctaaagaccggaacagacgagtgggtcagggtg
gctgagggagttccgaccactgagcatttgctcacagggctaatggaaggccaggaatac
tcattccgagtgagagccgtgaacaaggctggagagagtgagcccagtgaacccagcgac
cctgtgctttgccgggagaaactatatcctccatcaccacctcgctggctcgaagtgatt
aatatcacaaaaaatacagctgacctaaaatggacagttccagagaaagatggagggtca
cccatcaccaactacattgtggaaaagagagatgtgagacggaaaggctggcaaacagtg
gacaccactgtcaaggacaccaagtgcacggtcaccccactgacagaggggtctctgtat
gtgttccgagttgctgcagaaaatgccataggacaaagtgactacacagaaatcggagat
tctgtcctggccaaagacaccttcaccacccctggaccaccctatgccctgacagtggtt
gatgtgacaaaacgacatgttgacctaaagtgggagccacctaaaaatgatggcggaaga
ccaatacagagatacatcattgagaagaaagaaaaattaggtacccgttgggtgaaagcc
gggaagacctcaggccctgactgtaacttcagagtaactgatgtcattgaaggaacagaa
gtccagtttcaagttcgggcagaaaatgaagcaggagttggtcacccaagtgagcccaca
gaaattctgtcaatcgaagacccaacaagtcctccttcacctccgcttgatctacatgtg
actgatgctgggagaaaacacattgccattgcttggaaaccaccagagaaaaatggcgga
agtcctatcataggctaccatgttgaaatgtgtccagtaggcacagagaaatggatgcga
gttaattctcgcccaataaaagatctgaagttcaaggttgaagagggtattgttccggac
aaagaatatgttctgagagtgagagctgtcaatgctgtcggtgtcagtgagccatctgaa
atctccgaaaacgtggtcgccaaagacccagactgcaaaccaactattgatctagagact
cacgacattgttgttatcgaaggagaaaagttaaacatccctgtgcccttcagggctgtc
ccagtgccaaccgtgagctggcataaagatggcaaagaagttaaagcaagtgacagattg
acaatgaagaacgaccacatctctgcacacctcgaggttcccaagagtgtccatgcagat
gctggagtgtacaccatcaccctggagaataagctcggctcagcaacggcttcaatcaat
gtcaaagtcataggtctacctggtccatgcaaagatattaaagcaagtgacataaccaaa
agttcttgtaagttaacatgggaacctccagagtttgatggtggaagcccgattcttcat
tatgtcctggaacggagagaagcagggaggaggacatatatcccagtcatgtctggtgag
aacaaactgtcttggaccgtaaaagatctcataccaaatggtgaatacttcttccgagta
aaagcagtcaacaagattggcggaggagaatacattgaactcaagaatcctgtcattgct
caagatccaaagcaaccacctgatccacctgtagatgttgaggttcataatcctacagct
aaggcaatgactatcacgtggaagccacccttgtatgatggaggaagcaagataatgggt
tacatcatagaaaagatcactaagggtgaggatagatggaagagatgcaatgaacatctg
gtccctgtcctgacctacacagcgaaaggactcgaggaggggaaagagtaccaattccgt
gtgcgagcggagaacgctgctggtattggtgaaccttcccgggccactcccccaaccaaa
gctgtcgaccctattgatgccccaaaagtcatcctcagaacaagcctggaagtaaagcgg
ggtgatgaaatagcacttgatgcaaccatctctggctcaccatacccaacaatcacatgg
ataaaagatgaaaatgtcattgttccagaggaaattaagaagcgagcggcacccccagtt
aggaggaagaagggcgaggctgaagaggaggagcccttttccctccctctgacagaacgt
ctgagcatcaacaatagcaaacagggagaatctcagctgcgcatccgtgactctctgcgg
cctgaccatggccagtacatgatcaaagttgagaatgatcacggtgttgcaaaagctcct
tgctccgtcagtgtgttagatacaccaggaccaccaatcaactttgtatttgaggatatt
agaaaggactctgtcctgtgtaagtgggaaccaccgcttgacgatggtggcagtgaaatc
attaactataccttggaaaagaaagacaagaccaagcccgactcagactggattgttatc
acatcaacactcagaaactgcaaatattcagtaacaaaactgattgaaggaaaagagtac
ctcttccgtgtaagagctgaaaataggtttggacctgggccaccatgtgtttcaaagcca
cttttagccaaagatccatttgaaccacctgatgcaccagataaacccattgtggaagat
gtcaccagcaacagtatgctagtaaaatggaatgaaccgaaagataatggaagccccatc
ttgggttactggcttgaaaaacgtgaggtcaatagtacacactggtctcgtgtcaacaaa
acccttctcagttctttgaaaaccaaggtagatggcttgctggaaggactcacctatgtc
ttccgagtttgtgctgaaaacgctgctggacctggaaagttcagcccaccttcggatcct
aaaacagctcgcgatccaatctctccacctgggccgcctgtcccgagagttgctgataca
agctctacaaccattgagctggagtgggaacccccagctttcaatggtggtggggaaatt
atgggctactttgttgataagcagctggttggcacaaatgagtggtcacgctgcacagag
aagatgatcaaagtccgtcagttcactgtcaaagaaatccgagagggtgccgactacaaa
cttcgagtgagtgctgtcaatgcagcaggcgaaggaccacctggagaaacagaacctgtt
actgtggctgagccacaagagcctccaactgtggaactagatgtttctgtcaagggtgga
atacaaatcatggctgggaagactctcagaatcccagcggaggtgactggccgtcctgtg
cccacaaaagtatggaccatcgaagaaggggagctagataaagagcgtgttataatagag
aatgtcggaaccaaatctgaactaattatcaagaacgcattgagaaaagaccatggcaga
tacgtgatcacggcaacaaacagctgtggttccaaatttgccgcagtccgggttgaagtg
ttcgatgtccctggcccagttcttgacctcaaaccggttgtaacaaacagaaagatgtgt
ctgcttaattggtccgatccagcagatgatggcggaagtgacatcacagggtttataatt
gaaaggaaggatgctaagatgcacacttggagacagcccatcgagactgagagatccaag
tgtgacatcacaggccttatagagggacaagaatacaagttccgtgtcattgccaagaac
aagtttggctgtgggcctcctgttgaaataggaccaattcttgcagttgatccactaggc
cctccaacatctcctgaaaggctcacatacacagaaagaacaaaatccaccatcacactt
gactggaaagagccacgcagcgatggtggcagtcccattcaaggatatatcattgaaaaa
cgccgccatgacaaacccgactttgaaagagttaacaagagactctgcccaaccacatca
tttctggttgaaaatcttgatgaacaccaaatgtatgagttccgtgtcaaagccgtcaat
gacgttggtgaaagtgaaccatctctgcctcttaacgtagtcatacaggatgatgaagtc
cctcccactattaagttgcgcctggctgttcgaggagacactatcaaagttaaggcaggg
gagccagttaacatccctgcagacgtgaccggcctccccatgcctaagattgagtggtcc
aagaatgaaaaggtgattgataaacctacggatacactgaatataaccaaagaagaagtc
tcccgaagtgaggcaaagactgagcttagcatccctaaagcagcccgagaggacaagggc
acgtacacaatcacagcttccaatcgtcttggctccgtattccgcaacgttcatgtggag
gtttatgatcgtccatctccacccagaaacctcgctgttactgacatcaaagctgagtct
tgctatttgacgtgggatgcccctctagacaatggaggcagtgaaattactcattacatc
attgacaagcgtgatgccagcaggaagaagtccgaatgggaagaagtcactaacactgct
gttgagagaagatacgggatctggaagcttatccccaatggtcagtacgagttccgagtg
agggcagtgaataaatatggaatcagtgatgaatgcaaatcagacaaggtcgtcattcaa
gatccctaccgcctccccgggcctcctggaaaaccgaaagtcttagaacgtaccaaagga
tctatgcttgtgagctggacccctcctctggacaacggagggtctccaattactggctac
tggctagagaagagagaggaaggtggtacctactggtcacgtgttagcagagcaccaata
accaaagtaggactgaagggtgtggaattcaatgttccgcggttgattgaaggcgtcaaa
tatcaatttagagccatggcaataaatgctgcaggaattggccctcccagtgaaccatca
gacccagctgttgcaggagatcctatataccctcctgggccaccttcttgcccagaggtc
aaagataaaacaaaatcaagcatctcactagcatggaaacctccagccaaagacggtggc
agcccaatcaaaggctacattgtagagatgcaagaggagggaaccacggactggaagcca
gtcaatgaacccgataaacttctcactgcctgtgaatgtgtggtgcctaatctgaaagag
ctcaggaagtacaggttcagagtgaaagctgtcaatgaagctggagagtctgaaccaagt
gacacgaccggagagatccctgccactgatatccaagaagttccagaggttttcattgac
attggcgcacaagactgcctggtttgcaaagctggctcacaggtcaaaattcctgctgtg
atcaagggacgccccacaccaaaatcatcttgggaatttgatggaaaagcaaagaaggca
atgaaggatggagttcatgatatacctgaagatgcacagctggagacggccgaaaactca
tcggtcatcattatcccagagtgtactcgagctcactcgggcaaatacagcatcacagcc
aagaacaaagcaggacagaaaactgccaactgcagagttaaagtcatggacgcaccaggc
cctcccaaagatttgaaggtcagtgacatcacaaggggtagttgccgcctctcatggaag
atgccagatgatgatggaggtgataggatcaaaggctacgtcattgagaagaagaccatc
gacgggaaagcctggacgaaagtcaatccaaattgtggaagcaccacatttgtggtacca
gatcttatctctgagcagcaatacttcttccgtgttcgagcagaaaaccgttttggaatt
ggcccacctgcagaaaccatccagaggaccactgccagagacccaatatatcctcctgat
ccccctatcaaactcaagattggtctcataacaaagaacacagtgcacctgtcgtggaaa
cctccaaagaatgatggtggctctcctgtcacccattatattgttgagtgtttggcttgg
gaccctaccgggaaaaagaaagaagcctggaggcagtgcaataggcgtgatgtggaagaa
ctggagttcaccgtggaagacctcatagagggaggggaatatgaattcagagtcaaagcc
gtcaacgaggccggggtcagcaagccttcagccactgttggtcctgtgattgtcaaagac
cagacatgcccaccagccattgagctaaaagaattcatggaagttgaagaaggaactgat
gttaacattgtggccaaaatcaaaggtgtgccgttcccaactctcacctggttcaaggct
ccgccaaagaaacccgacagcaaagagcctgttgtttatgacacccatgtcaacaaacag
gtggtggatgacacttgcactttagtcattcctcagtctcgccggagtgacactggctta
tattctatcacagccgtaaacaacctggggacagcatcaaaggagatgagactcaatgtc
cttggtcgtcctggcccccctgtgggacccataaagtttgaatctatttcagcggatcag
atgacattatcttggcttccacctaaagatgacggtgggtctaagattacaaactatgtc
attgagaaaagagaagccaacagaaagacatgggtacgtgtctccagtgaacctaaagaa
tgcatgtacacaattcccaaattgctagaaggccatgaatacgtcttccgaatcatggcc
cagaataagtacggcattggagagccacttgacagtgaacctgagacagcacggaacctc
ttctctgtccctggagctccagataaaccaacagtgagcagcgtcactcgcaactccatg
actgtcaactgggaagagccggaatatgatggaggctctcctgtgacagggtactggtta
gaaatgaaagacaccacttcaaagagatggaagagagttaaccgagatcccatcaaagcc
atgactctaggtgtttcttacaaagtgactggccttattgaaggatcagactatcagttc
cgggtatatgcaatcaatgccgctggtgtgggtccagcaagtcttccctcagatccagtg
actgctagagatccagttgctccccctggtcctccattccccaaagtgacagactggaca
aaatcatctgtggacttagaatggtctcctccactaaaagatggcggatccaaaatcact
ggctacattgttgagtataaggaagaaggaaaagaagaatgggaaaagggtaaagataaa
gaagtgagggggacaaaactggttgttactggattaaaagaaggagccttctacaaattc
cgtgtgagagcagtcaatgttgctggtgttggggaacctggagaagtcacggacgttatt
gaaatgaaggacagaattgtgtcgcctgaccttcagcttgatgccagtgtcagagacaga
atagtggtccacgccggaggggtgatccgtatcattgcctatgtatctgggaagccacct
cccactgtcacctggagtatgaatgaaagagccttgcctcaagaggccgccattgagacc
acagcaattagctcatccatggtcatcaagaactgccagaggagccaccaaggcgtctac
tctcttcttgccaaaaatgaaggcggagaaagaaagaagacaattattgttgatgtacta
gatgtcccaggacctgttggaataccattcctctctgacaacctaaccaatgactcctgc
aaactgacatggttctctccagaagatgatggtggctctccaatcaccaattatgtcatt
cagaagcgggaagctgaccgcagggcatggacccctgtgacatacacagtcactcgacaa
aatgctactgttcagggccttattcaaggaaaatcctactttttccgaattgcagctgag
aatagcattggcatgggcccatttgttgagacaccaaatgcacttgtcattagagaccca
ataactgtgccagagagacctgaggacctggaagtcaaagaagtcactaaaaatactgtg
tctttgacttggaaccctcccaagtatgatggcgggtcagaaattataaactatgtccta
gaaagccgcctcattggtactgagaagttccacaaagttacaaatgacaacctgcttagc
aggaaatacactgtgaaaggcttaaaagaaggcgatacatatgagtaccgcgtcagtgcc
gtcaatatcgttggacaaggcaagccatcattttgcaccaagccaatcacttgcaaggat
gaactggctccacctacacttgacctcgacttcagagataagcttaccgtccgagttggt
gaatctttcgccctcactggccgatactcaggcaaaccaaagcctaagattgattggttc
aaagatgaagctgatgtactggaagatgatcgtactcacataaagaccactcccacgaca
cttgctcttgagaagacaaaggccaaacgctcagattctgggaaatactgtgtagttgtg
gagaacagtacaggctccaggaaaggtttctgtcaagtcaatgttgttgatcgtcctgga
ccaccagtaggacctgtcatttttgatgaggtgaccaaagaatacatggttatttcttgg
aagccacctctagatgatggaggaagtgaaattaccaattatattattgagaagaaggag
ctcggtaaagacatctggatgcctgtgacatctgccagtgccaaaactacatgcaaggtc
cctaaactgcttgaaggaaaagattacatcttccggattcatgcggaaaatctatatgga
ataagtgaccctctggtgtctgattcaatgaaagccaaagatcgattcagagtccctgat
gcacctgagcagccagttgtcacagaggtcaccaaagactcggcattagtaacctggaac
aagccaaatgacggaggaaagcccatcacaaactacatcctggaaaagagggaaactatg
tctaaaagatgggttcgagttaccaaagagcctattcatccatacactaagtatagggtt
cctgatcttctagaaggatgccagtatgaattccgtgtttctgcagagaatgaaattggt
attggagatccaagtccaccatccaaaccagtctttgctagagacccaattgctaaacca
agtccacctattaatcctgaggcaatagatacaacatgtaattcagttgagctaacttgg
cagccaccacgtcacgacggtggtagcaagatcctgggttatatcgtggagtaccagaaa
gttggggatgaagagtggagacgagccaatcacactcctgaatcatgccctgaaactaaa
tataaagtcactggcctcagggatggtcagagctacaagttccgagtactggcagtcaac
gaggctggtgaatcggacccagcccacgttcctgaaccagttctagtaaaggaccgactt
gaacctcctgagcttatacttgatgctaacatggcaagagaacaacacattagagttggt
gacaccctaagacttagtgccatcatcaaaggtgtgccattccccaaagtaacctggaaa
aaagaagacagagaggctccaacaaaagcccaaattgatgttactccagttgggagcaag
cttgaaatccgtaatgctgcccacgaagatggtggtatttattccctaactgtggagaat
ccggcgggtacaaagacagtctcagtcaaagtattggtcttagataaacctgggccacct
agagatctggaagtcagtgaaattaggaaagattcttgttacctgacttggaaggaacca
ctggacgacggtggttctgttgtaaccaattatgtggttgagaggaaagatgttgccact
gcccagtggtcccctctttccaccacgtcaaagaagaagagccatatggctaaacatctg
actgagggcaatcagtacctcttccgagtagctgctgagaaccaatacggacgtggtcct
tttgttgaaacacctaagcccatcaaggctctggatcctctccatcccccagggccaccc
aaggatctgcaccacgtagatgtcgacaagactgaagtctctctcgtttggaataagcca
gatcgtgatggtggttctccaatcacaggatacttagtggaatatcaagaagagggtgac
aaggactggatcaagttcaagactgtgaaaaatttagactgtgttgttacaggcttacaa
caaggaaagacctatagattccgtgtaaaagctgaaaatatcataggtcttggtcttcct
gatacaactatcccaatagaatgtcaagagaaactagtgcctccatctgtggaattagat
gtgaagttaattgaagggcttgtggtgaaggctggtaccacagttagattccctgccatc
ataagaggtgtacctgttcctactgcaaaatggacaactgatgggactgagattaaaaca
gatgaccactacacagttgagactgacagcttctcatccgtgctgaccattaagaattgt
ttaaggaaggatactggggaataccaactcacagtttccaatgcagcgggtaccaaaaca
gtagctgtccatcttactgttcttgatgtacctggtccaccaacaggtcctattaatatc
ctggatgtcacacctgaatacatgactatctcatggcaaccgcctaaggatgatggagga
agcccagtgataaattacattgttgagaaacaagatacaaggaaaggtacatggggtgtc
gtctctgcaggaagcagtaagctgaagctgaaggtcccacatctccaaaaaggctgtgaa
tacgttttcagagtcaaagcagagaacaagatgggtgtcggtcctccccttgactccata
cctactgttgctaagcacaagttcagtcctccatctcctcctggtaaaccagtggtaact
gacattactgagaatgctgcaacggtgtcttggacactgccaaaatctgatggtggcagt
ccaataactggctattatgtagagcgcagagaaataaccggcaaatgggtgagggtcaac
aaaacgcctattgctgacctgaagttcagggtgactggactctatgagggaaatacatac
gagtttagagtttttgctgaaaatcttgcaggtttaagcaatccatcacccagttctgac
ccaatcaaagcttgccggcccatcaaaccaccagggccacctataaatcctaagctgaaa
gacaagagcaaagaatctgctgacttggtgtggacaaagcccctcagtgatggtggcagc
cccattttggggtatgtagtagagtatcagaaacctggcacagcgcagtgggataggatt
aataaagacgaactcatcaggcaatgtgccttccgggtccccggactgattgaaggaaat
gagtacagatttcgcattagagcagctaacattgtgggtgagggagagccaagggagctt
gcagaatctgtgattgcaaaagacatccttcatcccccggaagtggaacttgacgttaca
tgccgtgatgtcattaccgtccgggtgggtcaaactatccgcattcttgcccgagtcaaa
ggcagacctgagccagacataacttggtccaaggaaggaaaagtactggtcaaagacaag
cgggttgacctaattcatgatctgcctcgtgttgagctacaaattaaagaagctgtcaga
gctgaccatggcaagtatatcatctctgctaagaacagcagtgggcatgcccaagggtca
gccattgttaatgtccttgacagacctgggccttgccagaatctgaaggttagcaacgta
accaaggaaaactgcaccatttcttgggaaaacccactagataatggtggctcagaaatt
acaaatttcatagtggaatatcgtaaaccaaatcagaaaggctggtcaatcgttgcctca
gatgtcaccaagagactggtcaaggccaacctgttagccaataatgaatactatttccgt
gtttgtgcagagaataaagtaggtgttgggccaaccattgaaacaaagactccaattttg
gccatcaatcctattgacaggccaggggagcctgaaaaccttcatattgcagataaagga
aagacctttgtctatctaaagtggcgacggcctgattatgatggtggtagcccgaatcta
tcatatcatgttgagaggagactgaagggctctgcagactgggaaagagtgcacaaagga
agcattaaggaaacccactacatggttgacaagtgtgttgaaaaccagatttatgagttc
agagtacaaactaagaatgaaggtggagaaagtgattgggtgaggacagaggaagttgtt
gtgaaggaagatttacagaagccagtacttgatctaaaattaagtggggtgctaactgtc
aaagcaggggacaccattagactcgaggcaggtgtgagaggcaaaccattcccagaggtt
gcctggaccaaagacaaagatgctacagatttaacaagatcaccaagggtcaagattgat
accagtgccgaatcatcgaaattctctcttaccaaagccaagcgaagcgatggcggtaaa
tacgtaatcaccgcaactaacccagctggcagttttgtggcctatgcgactgtcaatgtt
ttagataaacctggtcctgtaagaaacctgaaaatcactgatgtgtccagtgacaggtgt
actatccgctgggatccaccagaagatgatggcggctgtgaaatccaaaattatatccta
gaaaaatgtgagagcaagagaatggtatggtctacctattctgctaatgtcttgacaccc
agtgctacagtgactcgtctcatagaaggaaatgagtatattttcagagttcgtgcagaa
aacaaaataggcacagggcctccaacagaaagtaaaccagtcattgcaaaaaccaagtat
gacagacctggccgccctgatcctccagaagtcactaaagtaagcaaagaagagatgacc
gtggtttggaacgcccctgaatatgatggtgggaagtctatcacaggatactatttagag
aaaaaagaaaagcatgcagtccgctgggtccctgttaacaagagtgccatccctgagcga
cgcttgaaagtacagaatctcctcccagggcacgagtaccagttccgtgtcaaagcagaa
aatgaagttggcattggagaaccaagcttaccatcaagaccagtggtggcaaaagatccc
atagaaccacctgggccaccaaccaatttcaaagtggttgatacaaccaaaagttccata
actctcgcatggggaaaaccagtctatgatggtggtgcaccgataattggatatgtcgta
gagatgagacccaaaatagcagacgcatcacctgacgaaggctggaaaaggtgcaacgct
gcagctcaacttattcgcatggaattcacagtcaccagcttggatgagaaccaggagtac
gagttcagggtgtgtgcccagaatcaagttggcattgggcgccctgcagagctaaaggaa
gccatcaaacctaaagaaatcctagagcctccagagattgacttggatgccagcatgaga
aaactggtcgtagtgagagctggctgccctattcgactattcgcaatagtgagaggacga
cctgcccccaaagtcacatggcgcaaagtgggcattgataatgtggtcagaaaaggacaa
gtcgatctagttgacactatggccttccttgtcatccccaactctacccgtgatgactct
ggaaaatactccctgacccttgtgaacccagcaggagaaaaggctgtttttgtgaatgtc
aaagtactagatactcctggacctgtggctgatttaaaagtttcagatgtcactaaaaca
tcatgtcacgtgtcctgggcacctcctgaaaatgatggtggaagccaagtgacacattat
attgtggagaaacgtgaggcagaaagaaaaacatggtcaacagttacccctgaagtgaag
aaaacaagcttcaatgtaaccaaccttgtccctgggaacgagtatttcttccgagtaact
gctgtcaatgaatatggccctggtgtcccgacagacatccccaaacctgtgcttgcatca
gatcctctcagtgagccagatcctccaagaaaactggaggtgaccgaaatgacaaagaac
agtgctacactggcctggttacctccgttgcgtgatggaggcgctaaaatcgatggctat
atcattagttacagagaagaagaccaacctgcagatcgctggacagagtactcagtggtc
aaagacctcagccttattgttactggcctaaaggaaggaaagaaatataaatttagagtt
gcagctagaaatgctgttggagtcagcatgccaagagaggccgaaggcgtctacgaagca
aaagaacagctattgccaccaaagatcctcatgcctgagcaaatcactatcaaagccggg
aagaaacttcgagttgaggcgcatgtgtatggaaagcctaaccccatctgcaaatggaag
aaaggagacgacgaagttgttacatccagccacctggccatccacaaggcagacggctcc
tcagttctgatcataaaagacgttactagaaaagacagtggttactatagcctcacggca
gagaatagctccgggtcagacactcagaaaatcaaagttacagtcatggatgctcctggg
ccccctcagcctccatttgacatttctgaaatagatgctgatgcttgctccctgtcttgg
cacatccctctggaggatggaggcagcaacattaccaattacatagtagagaaatgtgat
gtaagccgtggcgattgggtcacagctctagcatcagtcaccaagacttcctgcagggtt
ggaaagctgatcccaggccaggagtatatcttccgggtccgagctgaaaacagatttggc
atttcagagcctctcacatctccaaagatgcttgctaagttcccatttgatgttcctagt
gagccaaagaatgcacgtgtcactaaagtcaacaaagactgcatatttgtcgcgtgggac
agaccagacagtgatggaggaagccccatcactggttacctgattgaacgcaaagaaaga
aacagtttgctctgggtgaaagctaatgacactattgtccggtcaactgagtatccttgt
gctggcctcgtagaaggtctagaatattcattcagaatctatgctctaaacaaagctggg
tccagcccacctagcaaaccaactgagtatgtgactgcaaggatgccggttgatccacca
gggaaacctgaagttgttgacgtcaccaagaacagcgcatcgcttatctgggcccggcca
aagcatgatggaggcagcagaattatcggctattttgtagaggcttgcaaacttcctggt
gataaatgggttcggtgcaataccacacctcaccagattccccaggaagagtacacagct
actgggttagaagagaatgctcagtatcagttcagagcgattgccaagactgctgtgaac
atcagccagccttccgagccttctgatccagtgaccattcttgcagaaaatgttcctcca
cggatagaactcagtgttgagatgaagtctttgcttaccgtgaaggctgggactaatgtc
tgcttggatgctactgtcttcgggaaaccgatgccaacggtttcttggaagaaagacacc
acaccaataaaacaagccgaaggcataaagatggcaatgaagcggaacttgtgtaccttg
gagctgttcagtgtgaaccggaaagactcaggagactataccattactgccgaaaattcc
agtggttccaaatcagccaccattaagctgaaagtactagataagccaggtcctccagca
tctgtgaaaatcaacaagatgtatgcagaccgtgcaatgctgtcctgggaacctcctctc
gaggatggaggctcagaaatcaccaactacatcattgacaagcgtgaaacaagcaggccc
aactgggcccaggtctctgctactgtgcccatcaccagctgcactgtggagaaacttata
gagggccatgaataccagttccgtatctgtgccgaaaacaaatacggagtcggcgatccc
atcctcactgagccagcgattgccaaaaacccatatgacccgcctggacgctgtgaccct
cctgtcattagcaacatcactaaagatcacatgaccgtcagctggaaagccccagcggat
gatggtggctcacctatcaccggatacttggttgaaaagcgggaaactcaggcagtcaac
tggactaaagtcaacagaaaacctgttatagaaaggacattaaaagcaacgggtctccag
gaaggcacggagtatgaattccgagttacggctatcaataaagctggacccggcaaaccc
agtgatgcatccaaagccgtgtatgctcaagacccactgtatcctcctggcccgccagct
ttccctaaagtctatgataccacccgtagttctgtgagtctatcatggggcaagccggcc
tatgatggcggcagccctatcattggttatcttgtggaagtaaagcgagctgattctgat
cactgggtgaggtgcaatttgccagagaagctccagaagacccgcttcgaggtgactggc
ctgatggaaaacaccgagtatcagttccgagtgtatgccgttaacaagattgggtacagc
gaccccagcgatgtgccagataaacactgccccaaggacatcctaattccacctgaggga
gaacttgatgctgaactaaggaaaacacttatcttacgtgctggagttacaatgagactc
tacgtgccagtaaaaggacggccacctccaaagattacttggtctaaaccgaacgtcaat
ctaagagaaaggattggcctggatataaagtcgacagactttgacaccttcttgcgctgc
gaaaatgtgaacaaatatgatgcaggaaaatatatcttaaccttggagaacagctgcggc
aagaaggagtacactattgtggtgaaagtgctggacactcctggtccacctgtcaatgtg
actgttaaggaggtatccaaggactctgcatatgttacctgggatcctcccattattgat
ggtgggagccccatcataaactatgtggttgagaaacgggatgcagagaggaagtcctgg
tcgacagtgacaaccgagtgctcgaagacaagcttcagagtctctaacttggaggagggg
aaatcctacttcttcagagtgtttgccgaaaatgaatacggcatcggggatccgggggag
acacgtgatgctgtcaaagcttctgaaaccccgggacctgtggtcgacctgaaagcactg
gctataactaagtcatcttgtaccatcggctggaagaagcctcgaagtgatggcggaagc
agaattactggctatgtggtggatttcctgacagaagaaaataagtggcaacgggtcatg
aaatcactgagccttcagtactccacaaaggatctgaaggaggggaaggagtacaccttc
agagtgagtgcagagaatgaaaacggagaaggaaccccaagtgaaattgtggttgtggcc
aaggacgatgttgtggctcccgatcttgacttgaaggatctacctgatctgtgctacttg
gctaaagaaaacagcaacttccgtctcaagatccccataaaaggcaaaccagcaccatcg
gtgtcttggaagaagggggaagatcccctagcaacagacacaagagtcagtgtcgaatca
actgcagttaacacaacccttgtagtatatgactgccaaaaatccgatgctggaaaatac
acaatcacactcaagaatgttgctggcaccaaggaaggaactctttctataaaggttgtt
ggcaagcctggcatccccaccggaccaatcaaatttgatgaagtcacagcagaagccatg
accttgaagtggggtcctccaaaggatgatggaggttctgaaatcaccaactatgtacta
gagaagagagactctgtgaataacaagtgggtgacatgtgcttccgctgtccagaaaacc
acctttagagtaaccagacttcacgagggcatagaatacaccttcagggtcagtgctgaa
aataaatatggtgtaggagaaggcctaaagtcagagccaattgttgccaaacatccattt
gatgtgcctgatgctcccccacctcccaatattgtggatgtcagacatgattcagtatct
ctaacatggactgatcccaaaaagactggtggctcaccaattacagggtatcatattgaa
ttcaaggaaagaaacagccttctgtggaagagagctaacaagactcctataaggatgaaa
gattttaaagtgacaggattaactgaaggtcttgaatatgaattcagagttatggctatc
aatctagctggagtgggcaagccaagcctgccatcagagccagttgtggcacttgatcca
attgatcctcctggaaaacctgaggttatcagcgtaacaaggaattcagtgactctcatc
tggacagaacctaaatacgatggtggccataaattaacaggatatatcgtggagaagcgg
gatctaccctctaagtcttggatgaaagccaaccatgttaatgtcccagactgtgccttt
actgtaactgatcttgttgaaggtggaaaatatgaattccgaatcagagcaaagaataca
gcgggtgctattagtgctccatcagagagcacaggaaccattatttgcaaggatgaatac
gaggcaccaaccattgtccttgatccaacaattaaagatgggctaacagtcaaggcaggg
gatagcattgttttaagtgccattagcattctcggcaaaccccttccaaagtcaagctgg
tccagggcaggaaaagatatcagaccatcagacatagctcaaataacttcaaccccaaca
tcttctatgctgacagttaagtatgccacaagaaaggatgctggcgagtataccatcacc
gctaccaatccttttggcacaaaggaggaacatgtgaaggtatcagtccttgatgtacct
ggtcccccaggtcccattgaaatcagtaatgtttcagctgaaaaagcaacacttacttgg
acacctcccttagaagatgggggctcaccgattaaagcttatgttcttgagaagagagaa
accagccggcttttgtggacagtggtttctgaagatattcaggcatgcagacatgtggta
accaaactcatccaaggaaatgaatacctcttccgtgtgtcagcagtaaaccattacggc
aaaggagaacccgttcagtctgagcctgtcaaaatggtggacagatttggtcctcctggc
cctcctggaaaacccgagatctcaaatgtcaccaagaacactgccactgtcagctggaag
aggccaactgatgatggtggcagcgagatcacaggatatcatgtagaaaggagagaaaag
aaaggcctgcggtgggtgagagcaaccaaaacaccagtttccgatctcaggtgcaaagta
actggactgcaagaaggaaatacctatgagttccgtgtcagtgcagaaaacagagccggg
attggtcctcccagtgacgcctcgaatcctgttctgatgaaagatgttgcatatccccca
ggaccaccttcaaatgcacatgtcactgataccaccaagaaatcggcttctttagcatgg
ggcaagcctcattatgatggtgggcttgaaatcactggctatgtggtagagcatcaaaaa
gtaggagatgatgcctggatcaaagacacaacaggaacagccctcagaatcactcagttt
gtggttcctgatcttcagactaaggaaaaatacaattttagaattagtgccatcaacgat
gcaggtgtgggggaaccagctgtgattccaaatgttgaaattgtagagaaggaagtggct
cctgattttgagctagatgctgagctgcgaagaacacttgtggttagggcagggctcagt
attaggatttttgtgccaattaaaggtcgtcctgcacctgaagtgacatggaccaaagat
aatatcaacctgaagcaccgagccaacatcgaaaacacagagtcatttactcttctcatt
attccagaatgtaacagatatgacactggtaaatttgtgatgaccatcgaaaacccagct
gggaagaaaagcggcttcgttaacgtcagagtcctagacacaccaggccctgtccttaac
ctaaggcctacagacatcacaaaggacagtgtcaccctacactgggacctacctctgata
gatgggggctcacgtataacaaattatattgtggagaaacgtgaagcaaccaggaaatcc
tactccacagtcactactaagtgccataaatgtacatataaagtgactggcttgacagaa
ggctgtgaatatttcttcagagtgatggcagaaaatgaatatggggttggtgagccaacg
gaaaccacagaacctgtgagagcctctgaggcaccgttacccccagatagccttaacatt
atggacattaccaagaacacagtcagcctggcgtggcctaagccaaggcatgatggtggg
agcaagatcactggctatgtgattgaagcccagagaaaagggtctgaccagtggacccac
atctcaacagtgaaagggttagaatgtgtggtgaggaacctaaccgaaggagaggaatat
accttccaagtgatggcggtaaacagtgcaggcaggagtgcccctagagagagcagacct
gtcattgtcaaagagcagacgatgctcccagagctggatctccgtggcatctatcagaag
ctagtcattgccagagctggtgacaacatcaaagttgaaatcccagtacttggtcgaccc
aagcccacagtcacatggaaaaagggagaccaaatccttaaacagacacagagagttaat
gttgaaaacacagcaacgtcaaccatcttaaatatcaatgagtgtgtcagaagtgacagt
ggaccctatccattaacagcaaagaacactgtaggagaggttggtgacgttataaccatt
caagtccatgatattccaggaccacctactggacccattaaatttgatgaagtttcatct
gactttgtaaccttctcttgggagccaccagagaatgatggaggtgtaccaataagcaac
tatgtagtagagatgagacagacagacagtactacatgggtggagttagcaacaactgtt
atacgtactacctataaagcaactcgtctgaccacaggagtggagtatcaattccgtgta
agggctcaaaacagatatggagttggaccgggcatcacatctgcatctgtagttgcaaac
tatccattcaaggtgcccgggcctcccggtacccctcaggttactgcagtcaccaaagac
tccatgacaatcagctggcatgaaccactttctgatggtggaagccccattttaggatat
cacattgaaaggaaagaacggaatggcatcctctggcagactgtgagcaaagcattagta
ccaggcaacattttcaaatcaactggacttaccgatggcattgcttatgaattccgagta
attgcagaaaacatggcaggcaagagcaagccaagcaagccatctgaaccaatgtttgct
ttggatcccattgacccacccgggaaaccagttcctctaaacattacaagacacacagtg
gcactgaagtgggctaagcctgaatataccggaggctttaaaattactagctatgtggtt
gaaaagagggaccttcctaatggacgatggctgaaggccaacttcagcaacattttagag
aatgaatttacggtcagcggcctaactgaagatgctgcatacgagttccgtgtgattgcc
aaaaatgctgccggtgccatcagtccaccgtctgagccatcagatgccatcacatgcagg
gacgacctggaggcaccaagaataatggtggatgttagatttaaggataccatcacatta
aaagctggcgaagcattcaagttggaagctgatgtttcaggtcgcccacctccaacaatg
gaatggactaaagatggaaaggagcttgaaggcacagggaaattagaaataaaaattgca
gacttctccactcatctgataaacaaggattcctcaagaacggatagtggggcttacatc
ctgacagcaaccaatcctggtggctttgccaaacacattttcaatgtcaaagttcttgat
agaccgggaccacctgagggacctttggctgtgtctgatgtgacatcagagaagtgtgtg
ttgtcatggttgcctccactggacgatggaggtgccaaaattgatcattacatcgtacag
aaacgtgaaaccagcaggttggcatggacaaatgttgccacagaagtccaagtaacaaag
ctgaaggttactaagctcctgaaagggaatgaatacatattccgtgtcatggcagtaaat
aaatacggggttggagagccacttgaatcagaacctgtgcttgcagtggatccatatgga
ccacctgacccacccaagaacccggaagttacaactatcaccaaggactccatggtcgtc
tgctgggggcatcctgactctgatggtggaagtgaaattatcaactacattgtggagcgg
cgtgataaagctggccagcgctgggtaaaatgcaacaaaaaagctctgactgacttaaga
tttaaagtatctgggctgacagaaggacatgaatacgagttcagaattatggcagaaaac
gcagctggaatcagtgctccgagtgctaccagcccgttttataaagcttgcgacactgtg
tttaaacctggcccaccgggtaacccacgtgtccttgatacaagcaggtcgtccatttca
attgcgtggaataaacccatttatgatggaggttcagaaatcactgggtatatggttgag
attgccctgcctgaagaagatgaatggcaggttgtcactccaccagctgggctcaaggca
acttcctataccatcaccagcctcatagagaatcaggaatataaaatccgcatttatgcc
atgaattctgagggacttggggaacctgcccttgttcccggaactccaaaggcagaagaa
agaatgttgcctccagagatagaactggatgctgacttacgcaaagttgtcactatacga
gcctgctgcaccttgaggctctttgttcccatcaaagggagaccagcacctgaggtcaag
tgggcccgagagcatggagaatctctggacaaggctagcattgaatccacaagctcttac
accctgcttgttgttggaaatgttaacagattcgacagtggcaagtacatactaacggta
gaaaacagctctggcagcaagtcggcgtttgtcaatgttagagtgctagatacgccaggc
cctccacagaatctaaagataaaggaggtcacaaagacatctgtcacattgacgtgggag
cctcctctcctggatggaggctcaaaaataaagaactatattgttgagaagcgagagtcc
acaagaaaggcatattcaaccgtggcaacgaattgccataagacgtcctggaaggtagac
cagctgcaagaaggctgcagttactatttccgtgtcctcgctgaaaacgaatatggcatt
ggactgcccgccgaaacagctgagtctgtgaaggcatcggagcgacctcttcctccaggg
aagataactttgacggatgtcacacgaaacagtgtgtctctctcttgggagaagccagaa
catgacgggggcagccgaattctaggctacattgtagagatgcagagcaaaggcagtgac
agatgggccacgtgtgccacagtgaaagtcacagaagccaccatcaccggcctgatccag
ggtgaggaatactctttccgtgtttcagcgcagaatgaaaagggcatcagtgaccccaga
caactgagtgtgccagtaattgctaaagaccttgttatcccaccagccttcaaactcctc
ttcaatacattcacggtactggcaggtgaagacctgaaaattgatgtaccattcattgga
cgccctccaccagctgtcacctggcataaagatgacatacctctgaagcaaacaactaga
gtgaatgcagagagcacggaaaacaattctctactgacaataaaggaagcctgccgagaa
gatgttggacattacacggttaaactgactaactcggcaggtgaagccactgaaaccctt
aatgttatcgttcttgacaagccagggcccccaacaggaccagtgaagatggatgaagtg
acagcagacagtgtcactctttcctgggaaccaccaaagtatgatggcggaagctctatc
aataattacattgtagagaaacgagacacatccacaaccgcctggcaaatcgtgtcagct
acggttgcaagaacaaccataaaggcctgcagactaaagactggctgtgagtatcagttc
agaattgcagcagaaaacagatatgggaagagtacctacctcaactcagagcctgttgtt
gcccagtacccattcaaagtgccagggccaccgggcacaccattcgtcacgcttgcctcc
aaagacagcatggaggtacaatggcatgagccagtcagtgatggtgggagcaaagtcatt
ggctaccatctagagcgcaaggaaagaaatagcatcctctgggtcaagctgaataagaca
cctattcctcaaaccaagttcaagacaactggccttgaagaaggcattgaatatgaattt
agagtgtctgcagagaacatcgtaggcatcggcaagccaagtaagccatcagaatgttat
gctgctcatgacccatgcgatccaccaggtcggccagaggcaatcattgtcacaaggaac
tctgtgactcttcagtggaagaaacccacctacgatggtggaagcaagatcactggttac
attgttgagaagaaagaattgcctgatggccgctggatgaaagccagttttacaaatatc
attgacacccagtttgaggtaactggcctactggaagatcatagatatgagtttcgagtt
atagctcgaaatgctgcaggagttttcagtgagccctcagaaagtacaggggcaatcaca
gcaagagatgaggttgagccacccagaataagcatggaccccaaatacagggacacggtt
gtggttcaagctggtgagtcattcaagatcgatgcagatatatatggcaaaccaataccg
accactcagtgggtaaagggtgaccaggagctttcaagcacagctcggttagaaattaag
agcaccgactttgccaccagtctcagtgtcaaagatgcggtacgtgtggatagtggcaat
tatatcctaaaggccaaaaacgttgcaggggagaaatcagttactatcaatgtcaaagtt
ctcgatagaccagggccacctgagggacctgttgctatatcaggggttacagcagaaaaa
tgtactctagcttggaaacccccacttcaggatggtgggagtgacatcacaaattacatt
gtggaaaggcgagaaaccagccgcctcgtctggactctggttgatgccaatgtgcaaacg
ctcagctgtaaagtcctgaagcttcttgagggcaatgaatatattttccgtataatggct
gtgaacaaatacggtgttggtgaacctcttgaatctgagtcattgattgccaagaatcca
tttgtagtcccagatgcacccaaagctccagaagttacagctgtgaccaaagactcaatg
attgttgtatgggaaaggccagcgtctgatggtggcagtgagattctaggatatgttcta
gaaaaacgggacaaagaaggcataagatggacaagatgccacaagcgtctaattggagag
ctgcgcctgagagtgactggactgttagaaaatcacaattatgaattcagagtctccgct
gaaaatgctgctggacttagtgaaccaagccccccttctgcttaccagaaggcatgtgac
cccatttataagccaggccctccaaacaaccccaaagtcatggatgttaccagatcttcg
gttttcctttcttggaccaaacctatctatgatggtggctgtgaaatccaaggatacatc
gtagaaaaatgtgatgtgagtgttggtgaatggacaatgtgtacgccaccaactggaatc
aataagacaaatctagaagtcgagaagttgttggaaaagcatgaatacaacttccggatc
tgtgccattaataaggccggagtaggggagcatgctgatgtccctgggcctgtaatggtt
gaagaaaaacttgaagcacctgatatagaccttgaccttgaactaaggaaagtgattaat
ataagggcaggtggttccttaaggctgtttgttcctataaaaggccgtcctacaccagaa
gtcaagtgggggaaggttgatggtgatatccgggacgcagctataattgatgtcactagc
agcttcacctctcttgttcttgacaatgtcaatcgatatgatagtggaaaatacactctc
acactagaaaacagcagtggaacaaaatctgcctttgtgacggtaagggtcctggacaca
ccaagcccacctgtcaacttaaaagtcacagaaatcaccaaggactcggtatcaattaca
tgggaacctcctttgttggacggaggatcaaaaattaaaaattacattgttgagaaacga
gaagccacaagaaaatcctatgctgcagttgtaacaaactgccataagaattcgtggaaa
atcgatcagctccaagaaggttgcagttactacttcagggttaccgctgagaacgaatac
ggtattggcttgcctgcccgcactgcagatccaatcaaggttgcagaagtcccacaacct
ccagggaaaataactgtggatgatgtcaccagaaacagtgtctctctcagttggacaaag
cccgaacatgacggtggcagtaaaatcatccagtatatcgtagaaatgcaagctaaaaac
actgataagtggtcagagtgtgctagggtgaagtcccttgacgcagttattaccaaccta
actcagggagaagaataccttttcagagtcattgctgtaaatgaaaaaggaagaagcgac
cccaggtcccttgcggttccaatcatcgccaaagatctggtcatcgagccagacgtgaga
ccagcattcagcagttacagtgtacaggttggccaagacttgaaaatagaagtgccaatt
tctggacgtcctaaaccaagcatttcctggactaaggatgggatgccattgaagcagacc
acaagaatcaatgttaccgactccctggacctcaccacactcagcattaaagaaactcat
aaggatgatggtggacagtatggaatcacagtttccaatgtggtgggtcagaaaacagca
gctattgaaatcataactctagataaacctgatcctccaaaagggcctgttaaatttgat
gagatcagtgctgagagcatcacattatcctggaaccctcccttatatacagggggctgt
caaattaccaactacattgttcagaaaagagacacaaccaccacagtatgggatgtcgtc
tctgctactgttgccagaacgaccctcaaagtaaccaagctgaaaacgggtacagaatac
caattcagaatatttgctgaaaaccgatacggacaaagctttgctctggagtctgagcca
gttgtagctcaatatccctacaaagaaccaggccctccaggaacgccatttgtcacagcc
atctccaaagagtctatggtggtacagtggcatgaaccgatcaataatggtggaagccca
gtcataggttaccaccttgagagaaaggaaaggaatagtattttgtggacaaaagtcaac
aaaaccattattcatgacacccagtttaaagcactgaaccttgaagaaggcattgagtat
gaatttagagtttatgctgaaaatattgttggggtaggcaaggcaagcaagaattctgaa
tgctatgtagccagagacccctgtgacccaccaggtaccccagaagcaataatagttaag
agaaatgaaatcactttacagtggaccaagcctgtgtacgatggtggcagtatgatcaca
ggttacatcgtagagaaacgtgatttacccgagggtcgctggatgaaagccagtttcaca
aatgtcattgaaactcaattcaccgtgtcaggtcttactgaagatcaaagatatgaattc
agagtcattgcaaagaatgcagctggggcaataagtaaaccctctgacagtactggacca
ataactgccaaggatgaggttgaactcccacgaatttcaatggatccaaaattcagagac
acaatagtggtaaatgctggagaaacattcaggcttgaggccgatgtccatggaaaaccc
ctacccaccattgagtggttaagaggagacaaggaaattgaagaatctgccaggtgtgaa
ataaagaacacagatttcaaagctttacttattgtaaaagatgccattcgaattgatggt
ggacagtatattttaagagcctcgaatgttgccgggtctaagtcatttccagtaaatgtg
aaagtgctagacagaccaggaccaccagaagggccagttcaggttactggagtcacagct
gaaaagtgcactttggcatggtctccaccacttcaagatggtggcagtgacatttctcac
tacgtggtagaaaagcgagaaaccagtcgacttgcatggactgtggttgcttcagaagtt
gtgactaattctctgaaagttaccaagctcttagaagggaataaatatattttccgaata
atggctgtcaacaagtacggtgtcggggaacctttggaatctgctccagtactcatgaaa
aatccatttgtgcttcctggaccaccaaagagcttagaagtcacaaacattgccaaagac
tccatgacagtctgctggaatcggccagacagtgatggtggcagtgagatcattggttac
attgtggagaagagagacagaagtggcattcggtggatcaagtgtaacaaacgccgcatt
acagatttgcgactcagggtgacaggattaacagaagaccatgagtatgaattcagagtc
tctgcagaaaatgctgctggagttggagaaccaagtcctgctaccgtttactataaggca
tgtgatcctgtgttcaaacctggcccacccaccaatgcacacgttgtagacaccactaaa
aattcaattacacttgcctggagcaaacctatctatgatggcggcagtgagatcctgggc
tacgttgtagaaatctgtaaagctgatgaagaagaatggcaaatagttactccacagact
ggcctgagagtcactcgatttgaaattgccaaactaatcgaacaccaagaatataaaata
cgagtttgcgccctcaacaaagttggtttaggtgaggctgcctcagttcctggtacggtg
aaaccggaagataaactcgaggcacctgaacttgaccttgactctgagttaaggaaaggg
atcgttgtcagagctggtggatctgccagaatccatattccattcaagggtcgtccaacg
cctgagatcacttggtcaaaagaggaaggtgaattcacagataaggtccaaattgagaag
ggaattaacttcacccaactctcaatagataactgtgacagaaacgacgccgggaaatac
atcctcaagttggagaacagcagcggatcaaagtcggctttcgtaaccgtgaaagtactt
gacacaccaggaccgccacagaatctggctgtcaaggaagtgagaaaagactctgtcctt
ctggtatgggagccacctatcattgacggtggggcaaaggtcaagaactatgtcatcgac
aagcgcgagtccactcgaaaagcatatgctaacgtgagtagtaaatgcaataaaacgagc
ttcagagtcgagaacctgaccgaaggagccatctactactttagagtcatggcagagaat
gaatttggggttggtgttcccacggagacatctgatgctgtgaaagcttctgagcctcct
tccccaccaggaaaggtcacactcactgacgtgtcccagaccagtgcatcccttatgtgg
gagaaacccgagcatgatggagggagcagaattctgggctatgttgttgaaatgcagccc
aaaggaacagaaaagtggagcgttgtggctgaatccaaagtctgtaatgcagtggttagt
ggcctgagctccgggcaagaatatcagttccgtgtcaaagcttacaatgagaaaggaaaa
agtgacccgagagtgcttggcattcctgtcatagccaaggacttgaccatccagcctagt
tttaagctgccatttaatacatatagtgtccaagcgggagaggatctgaaaatagaaatt
ccagtcataggcagaccaagacctaaaatttcttgggtcaaagatggtgagcctcttaaa
cagaccaccagagtaaatgttgaagaaacggctacttcgactattttacacattaaagaa
agcagcaaagatgacttcgggaaatacagtgtcacagcaacaaacagtgcaggcacagca
acagaaaacctcagtgttattgttttagaaaagcctggtcctcccgttggaccagtgaag
tttgatgaagttagtgcagactttgtggtcatatcttgggaacctcccgcctatactggt
gggtgccaaatcagcaactacattgtagagaagcgagatactaccactaccaactggcag
atggtgtcagcaacagttgccaggacaaccattaaaataagcaaactgaaaacaggcacc
gaataccagtttaggatttttgctgagaacaggtatgggaaaagcactcccctggattct
aagcccgttgttgtacaatatccatttaaagagcctggaccacctggaaccccttttgta
acatctatctccaaagatcaaatgcttgtgcagtggcatgagccagttaatgatggaggc
agcaaagtgactggctaccatcttgaacagaaggaaaagaatagcatcctgtgggtcaag
ttgaataagatccccatccaagacaccaaattcaaaacaacggggcttgatgaagggctt
gaatatgagttcagggtttctgccgagaacattgtgggcattggcaagcctagcaaagtg
tcagagtgctatgttgcgcgtgatccgtgtgacccacctggtcgacctgaagccatcgtc
attacaagaaacagcgtcacgctgaaatggaagaaacctgtttatgatggtggcagcaag
ataacgggttacatcgtagaaaagaaagaccttcctgacggccggtggatgaaagccagc
ttcaccaatgttgtggaaactgagtttacagtgactgggcttgtagaagaccaaagatat
gaatttagagtcattgcaagaaatgcggctgacaactttagtgagccatctgaaagcagt
ggcgccatcactgcaagggatgaaatcgatgcaccaaatgcctcgctggatcctaaatac
agagatgtcatcattgttcatgcaggagagacctttgttctcgaagctgatatccgtggc
aaacccatacctgacatcatatggtcaaaagatgggaacgaactcgaagaaacagcagct
aggatggaaattaaatctactctgcagaaaacgactctcattgtcaaggactgtatacgc
accgatgggggacagtataccttgaaactcagcaatgtcgggggcaccaagactatacct
attaccgtgaaggtgctggataggccagggcctcccgaaggacctctgaaagttactgga
gttacagccgaaaagtgttacctggcatggaacccacctttgcaagatggtggtgctagt
atttcacattacatcattgaaaagagagagacaagcagactctcctggacccaggtttca
aatgaagtacaggccctcaactacaaagtcacgaagttgcttcctgggaacgagtatatt
ttccgggttatggcagtgaataaatatggaattggagaggccctggagtctgaaccggtg
atagcctgtaacccatacaagcgtccaggtcctccttcaacacccgaggcctcagccatc
accaaagactctatggtactaacatggacacgtccagtggatgacggaggtgctgaaatt
gaggggtacattcttgaaaagcgagataaggaaggcatcagatggaccaagtgcaacaag
aaaacattaacagaccttcggttcagggtgacaggcctcacagaaggccactcctatgaa
ttcagagttgctgctgagaacgcagctggtgtcggggaacccagtgagccgtccgttttc
taccgtgcatgtgatgccttgtatccaccaggtccaccaagcaaccccaaagtgacagac
acctccaggtcttctgtctccctagcatggaataagccaatttatgatggtggtgcaccc
gttagaggatatgtgattgagctcaaaaaagctgcggctgacgaatggactacctgtacg
ccaccatcgggattacaagggaagcagttcacagtgaccaagcttaaggagaatacagag
tacaacttccgcatctgtgctttcaatactgaaggtgtaggtgagcctgcaacgatacca
ggctccgttgttgctcaggagaggatggaagcaccagaaatagaactggatgctgatctc
agaaaggtggtcactctgcgtgcaagtgccactttgcgcctatttgtcactatcaaaggc
cgcccagaacctgaagttaagtgggaaaaggctgaaggcattctcacggaaagagcccag
atcgaggtgacgagttcttatacaatgctggtgattgacaacgtgaccagatttgacagt
ggtagatacaacctcaccctagaaaacaacagtggctccaaaacggcttttgtcaatgtc
agagttcttgactcaccaagcgcacccgtgaatctgaccataagagaagtgaagaaagac
tcggtgacgctgtcctgggagccaccacttattgacggtggagcaaagattacaaattat
atcgttgaaaaacgagaaactacaagaaaagcttacgctaccattacaaacaactgcact
aagaatactttcaaaatcgaaaatctacaagaagggtgttcttattacttccgagtcctg
gcttctaatgaatatgggattggtttgccagccgaaacagcagagcctgtcaaagtgtcc
gaaccaccactcccacctggaagggtaacccttgtagatgtgacccgtaatacagctacg
attaagtgggagaagccagagagcgatggcggcagcaagatcactggttatgttgtggaa
atgcagacaaagggcagtgaaaagtggagcgcatgcacacaagtgaagactttggagaca
actatatctggcctaactgcaggggaagagtatgtcttcagggtagctgcagttaatgaa
aaaggaagaagcgacccaagacagcttggggtgccagtcattgcaaaagacattgaaata
aagccctccgttgagcttccttttaatactttcaacgttaaggctaatgaccaactcaaa
attgacataccatttaaaggaagacctcaagctaccgtggcctggaaaaaagatggtcag
gtccttagagagacaactagagtcaacgtagcttcctcaaagaccgtaacaaccctatct
attaaagaagcctcaagggaagatgttggaacttacgaactatgtgtttcaaatactgct
ggatccataacagttcctattactgtcattgtccttgacaggccaggacctccaggaccc
atacgaattgatgaagttagttgtgacaatgtgtctatttcttggaatcctccagagtat
gatggtggctgccaaattagcaactacattgttgaaaagagagaaaccacttctacaacg
tggcaggtagtttcacaagcagtggcaagaacatccattaagatagtccgtctgacaaca
ggaagtgagtatcagttccgtgtctgtgcagagaatcggtatggaaagagttcctacagt
gagtcctcagccgttgtcgctgagtatccattcagccctcctgggcctcctggtactcct
aaagttgtgcatgccacaaaatctaccatggttgtaagctggcaagtaccagttaatgac
ggagggagccaagtgattggctatcaccttgaatacaaagaaagaagcagcattctctgg
tcaaaagcaaacaaagtcctcattgcagatactcagatgaaggtctctggtctggatgag
gggctgatgtacgagtatcgtgtatatgctgagaatatcgctggaattggtaaatgcagt
aaagcctgtgaaccggtccctgcaagagacccttgtgaccctcctggacaacctgaagtc
accaatatcacaagaaaatcagtgtcacttaagtggtctaaaccacgttatgatggtgga
gcgaagatcaccggatacattgttgaacgcagagagctaccggacggcaggtggctgaag
tgcaatttcaccaacgttcaggaaacatactttgaagtaactgagctaactgaagaccag
cgttatgaattccgggtttttgcaagaaatgctgctgattcagtcagtgagccatctgaa
tccactggacctatcacggtgaaagacgacgttgaggcgccaagaattatgatggatgtc
aaattccgagatgtcatcattgtcaaggccggagaagtccttaagataaatgcagacatt
gcagggcgacctctgccggtaatttcctgggccaaagatggggtagaaattgaagaaagg
gcaaaaacagaaattgtctcaacagactatactaccacattaacagttaaagactgtgta
agaagagacactgggcagtatgtccttacactgaagaatgtggcaggaactcggactatg
gcagttaactgtaaagtacttgataagcctggcccgccagcagggccacttgaaataaat
ggcctcactgctgagaagtgctccctttcctggggacgtccccaggaagatggcggtgca
gatattgattattatatcgtagaaaaacgtgaaacaagccgccttgcatggaccatatgt
gaagcagagttaaggacaacatcttgtaaagtgaccaagctactcaaaggcaacgaatat
atcttcagagtaactggtgttaataaatatggtgttggtgagcccttggagagcatggcc
gtgaaggcgctagatccattcaccactcctagcccacccacatctttggaaattacatct
gtgaccaaagattccatgacactttgctggtcaagacctgagactgatggaggcagtgac
atctctggatacataatcgaaaggcgtgagaaaaacagtctacggtggatgcgtgtgaac
aagaagccagtgtatgatctgagagtgaagtccacaggactccgagaaggatgtgaatat
gagtatcgggtttttgctgaaaatgctgccggcctgagtcttccaagtgaaacttctccc
ttggttcgagcagaagaccctgtgttcttgccatctcctccatctaaacccaaaatagtg
gactcgggcaagacaacaatcaccattggctgggttaaacctttgtttgacggtggggct
ccaataacgggatataccgtagaatacaaaaagtctgaggaaaccgactggaaagttgcc
attcagagcttcagaggcacagaatacacaatgagtgggctaacaacaggagacgagtat
gtttttagagtgaggtcactcaataagatgggtgccagtgaccccagtgatagctccgat
ccccaggtagccaaagagagagaagaagaacctgtatttgacgttgacagtgagatgagg
aagaccttgattgtcaaggctgggtcctcgtttaccatgacagttcctttcagaggaaga
ccaatccccaacgtctcctggagtaagcccgacaccgacctccgcacgagagcgtacatc
gactccacagattctcgtacattacttactattgagaatgccaacagaaatgattctgga
aaatacacgctgacaattcagaatgtgctgagcgctgcttccatgaccttcgtcgtcaaa
gtcttagattccccggggcctccagccaatattactgtacgtgaagtaaccaaggaaact
gctatgctgtcctgggatgttcctgaaaatgatggcggagcaccggtgaagaattaccac
atagaaaaacgtgaggccagcaagaaggcgtgggtgtcggtcactaacaactgcaaccgc
ctctcttacaaagtgaccaacttacaggaaggagctatctactacttccgagtctctggg
gagaacgagtttggtgttggtgtgccagctgagacaaaggaaggagtcaaaataacagaa
aaaccaagcccaccagaaaagcttggtgtaacaagtgtatccaaagacagtgtctcattg
agctggctgaagccagaacacgacggtggtagcagaatcatacactatgtcgtcgaagca
cttgaaaaaggacagaaaacgtgggttaagtgcgctgtggtgaagacaacccaccacgtt
gtttccggtctgagagagagtcatgagtacttcttccgggtctttgcagaaaaccaagct
ggtctgagtgaccccagggagctcctgcttcctgtcctcatcaaggaccagctagaacca
cccgaaattgatatgaagaatttcccaagtcacactgtgtatgtaagagctggttccaac
cttaaagttgacattccaatttctggaaaaccattacccaaagtgaccttatcaagagat
ggtgtaccactgaaggccaccatgagatttaatactgagattaccgctgagaacctgacc
atcaatctcaaagaaagtgttaccactgacgctggaagatatgagatcactgctgccaac
tccagtggaaccaccaaaactttcattaacatcattgtgctggacaggcctggaccccct
actggccctgtagccattagtgatataactgaagaaagtgtgactctcaaatgggagcca
ccaaagtatgatggcggaagccacgtcaccaattacattgtcctgaagagagaaacaagt
actgcagtgtggtctgaagtgtcagcaacagtagcaagaaccatgattaaagtcatgaaa
ctaaccacaggagaagaataccaattccgcatcaaggcagaaaatcgcttcggcatcagt
gatcatatagattcagtgtgtgtggttgtcaaactaccatacactacacctggaccacca
tctacaccctgggtatctaacgttactcgagaaagcatcactgtgggttggcacgaacca
gtgtccaatggaggtagtgcagtcacgggctaccacctggaaatgaaagacagaaatagt
attttgtggcagaaagccaacaaaatgatcatccgtacaactcacttcaaagttacaaca
atcagcgctggacttatttatgaattcagggtgtatgcagagaatgctgctggtatcgga
aagcccagtcacccatctgaaccagtcttggccattgatgcctgcgaacccccaagaaat
gtgcggatcactgatatctcaaagaactctgtcaacctttcatggcaacaaccagctttt
gatggaggaagcaagattacaggctacattgttgagaggcgcgaccttccagatgggaga
tggaccaaggctagcttcaccaatgttattgagactcaattcactgtctctggattgact
cagaattcccagtatgaattccgggtctttgctagaaatgctgttggttctgtcagcaac
ccatctgaggttgtaggccccatcacatgcattgactcttatggtgggcctgtgattgac
ttgcctctagaatatacagaagttgtcaaatatagagcaggtacctccgtgaagctcaga
gctggtatttccggcaaacccgagcctacgattgagtggtacaaagatgataaagaatta
caaaccaatgcattggtgtgtgtggaaaatagcactgaccttgcatctatactcatcaaa
gatgccaaccgccttaacagtggaagctatgagttgaaactgaggaatgccatgggttcc
gcctcagccaccatcagagtacagatccttgacaaaccaggacctccaggcggaccaatt
gaatttaagactgtcactgcagaaaagataactctgctctggaggcccccagctgacgac
ggtggcgcaaagatcacgcactacatcgtggaaaaacgggagacaagccgagtcgtgtgg
tctatggtggctgaaaatctggaagagtgcatcgttacaactaccaaaattatcaaaggg
aatgagtacgtcttccgagtccgagctgtgaataagtatggaattggcgagccgctagaa
tctgagccagttgtagccaagaatgcctttgttacacctgggcctccaagcatcccagag
gtgacaaagattaccaagaattcaatgactgttgtctgggacaggccaactgtagatggt
ggcagtgaaataaatggctatttccttgaaagacgagacaagaagagtctagcgtggctt
aaagtattaaaggagactattcgtgacaccagacaaaaggtgacaggactcacggaaaac
agtgactatcagtatcgagtctgtgctgtaaatgctgctggagtgggtccattctcagaa
ccatccgacttctacaaggctgctgatccaattgatcctccaggaccacctgccaagata
agaattgcagactcgaccaaatcatccatcacccttggctggagtaagcctgtctatgat
ggtggcagtgatgttactggatatgtggttgagatgaaacaaggagatgaagaagaatgg
accattgtctctaccaggggagaggtcagaactacagaatatgtggtctctaacctgaaa
cccggagtcaattattatttccaagtatcagcagtaaactgtgccggccaaggagaacct
ataacaatgactgaacctgcacaggctaaagatgtccttgaggaaccagaaatcgaccta
gatgtggctctcagaacatctgttatagctaaagctggtgaagatgtccaactactgatt
ccctttaaaggcagaccgccacctactgtcacctggaggaaagatgagaagaatcttggc
agcgataccagatacagcatccaaaacactgattcgtcttctttgcttgttattcctcaa
gtcactcgcaatgatacaggaaaatacatcctgacaatagaaaacggagtaggccaacca
aagtcttccaccgtgagtgttaaggtgctcgacacaccagctgcctgccagaagttacag
gtgaaacatgtttccctaggcacagtcacattgctctgggatcctcctctcatcgatgga
gggtctcccatcattaactatgtcatcgaaaagagagatgccacgaagagaacatggtct
gttgtgtcacacaagtgttccggcacatcctttaaagtaacagatttatcagagaagact
ccattcttcttcagggttcttgcagaaaatgaaattggcattggtgagccttgcgagacc
acggagcccgtgaaggctgctgaggtgccagcacctatccgagatctctcaatgaaagat
tccacaaagacatctgttgtcctgagctggaccaagcctgactttgatggtgggagcatc
atcacagactatctggtggaacggaaaggcaaaggtgaacaagcatggtcccatgctggc
atcagtaagacatgtgagattgagattggacaacttaaagagcaatcagtcttggaattc
cgagtgtctgctagaaatgagaaaggacagagcgaccctgtcactattgggccacttaca
gtgaaggagcttgtaattacacctgaagttgacttgtcagaaatccctggggcacaaata
tctgtgagaattggacataacgtacaccttgaattaccttataaaggaaaacccaagcca
tccatcagttggctgaaagatggcttgccactgaaggaaagtgaatatgttcgtttcagt
aagacagaaaacaaaatcaccttgagtattaagaattcgaagaaagagcatggagggaaa
tatactgttattcttgataatgcagtgtgtagaaactcattccccattacaatcatcacc
ctcggcccaccgtcaaagcccaaaggacccattagatttgatgaaatcaaggctgacagc
gccatcatgtcatgggacatacctgaagatgacggaggaggagaaatcacctgttacagc
attgagaagcgggaagcatcacaaacaaattggaagatggtgtgttcaagtgttgccaga
acaactttcaaagtttccaatctggtcaaagattctgaataccagtttagagttagagca
gaaaatagatatggagtcagtgagccacttgcctcaaatatcatcgtggcaaaacaccaa
ttcaggattcctggtcctccaggaaagccagtcatctacaatgtaacttcggatggcatg
tcactaacttgggatgcaccagtttatgatggtggttcagaagttactggattccatgtt
gaaaagaaagaaagaaacagcattctttggcaaagggttaacacatcaccaatatctggg
agagaatacagagctactggcttaatagaagggctggactatcaattccgtgtatatgct
gagaattctgctggcctgagctcacctagtgacccaagcaagtttacattagctgtttcc
ccagtagacccacccggcactcctgactacattgatgtcacccgggaaaccatcacactt
aaatggaacccaccattacgtgatgggggcagtaagatcgtggcctacagcattgagaag
cggcaaggaagtgaccgctgggtgagatgcaacttcactgacgtcagtgagtgtcagtac
acagttacgggactcagtcctggagatcgatatgagttcagaataattgcaagaaatgct
gttggcactataagccccccctcacagtcttctggcctcattatgacaagagatgaaaac
gttccaccaacagtagaatttggccctgagtacttcgatggtcttgttattaagtctgga
gacagtcttaggatcaaagctttggttcaaggacgaccggtcccacgagtaacttggttc
aaagatggagttgaaattgagaggagaatgaacatggaaataactgatgttcttggctct
accagcctctttgtcagagacgcaactcgagatcaccgtggtgtttacaccgtggaagcc
aaaaatgtatctggttccacaaaagcagaagttacagtgaaagtacaagatacaccagga
aaagtagtcgggccaataagatttactaatattactggtgaaaagatgaccctgtggtgg
gaggcacctctcaatgacggctgcgctcctgtcacgcactacatcattgaaaagcgtgaa
accagcagacttgcttgggcattgattgaggataattgcgaagccctaagttacactgcc
attaaactaatcactggcaatgagtatcagttccggatttctgcagttaacaagtttggt
gttggcaggccacttgagtccgaccccgtggttgctcaaatacaatacaccattccagat
gctcccggagttccagaacctagcaatgtcacaggcaacagcattaccctgacttggacg
aggccagaatcagatggtggcagtgagattcaacactacatccttgaaaggagagaaaag
aaaagcacaagatgggtaaaagtgatcagcaaacgaccaatctctgagacaaggttcaaa
gtcacaggtctggtggaaggcaacgagtatgagttccatgtcatggctgaaaacgctgcg
ggcataggaccagcaagtgggatctcaagactcattaaatgcagagagcctgttaaccca
ccaagtgccccctcggtagtcaaagtgacagacacatcaaagacaactgtgagcttggaa
tgggccaggccagtctttgacggcgggatggagataattggatacataatagaaatgtgc
aaagctgacttaggggactggcacaaagtaaacacagagccatgtgtgaaaacaagatac
acggtcactgatctacaggctggtgaagaatacaaattccgggtcagtgcggtcaatggt
gctgggaaaggagacagctgtgaggtgaccggcacaataaaagcagtcgatcggttatca
gctcccgagttagacattgatgcaaacttcaagcagactcacattgttagagcgggagtt
agcattcgtctcttcattgcctaccagggtagacccactcctacagcagtatggagcaag
cctgactctaaccttagcatccgggctgatatccacacaacagactccttcagcaccctc
accgtggaaaactgcaacagaaatgatgcagggaaatacacactcacggtagaaaacaac
agcggtaagaagtcgataacattcactgtaaaggtgctggactctccaggaccacctggt
cccattaccttcaaagatgtgacccggggatctgctacactgatgtgggacgcccctctc
cttgatggtggtgcccggatccatcactatgtgatagagaagcgggaagcgagtcgccgt
agctggcaggttgtcagtgaaaaatgcactcgccagatcctcaaggtgagtgagctgaca
gaaggtgttccgtactatttccgtgtttctgctgaaaatgagtacggtgttggtgaaccc
tatgaaatgccagaaccaattgtagccacagaacagcccgctccacctaggaggcttgat
gtcgttgacactagcaaatcctctgcggtcctagcctggcttaaacccgatcatgatgga
ggtagtcggatcactagctacctgcttgaaatgcgacaaaagggatctgacttctgggtt
gaagctggtcacaccaaacagctgactttcacagtggagcgcctcgttgagaatactgaa
tatgaattccgggtgaaagccaagaacgacgctggctacagtgaacccagggaagccttc
tcatctgtcattatcaaggagcctcaaattgagcccactgctgatctcactggaatcacc
aatcagctcatcacttgcaaagcaggaagcacatttaccattgacgtgccaatcagtggt
cgtcctgcccccaaagtaacatggaagctagaagaaatgagactcaaggagacagatcga
atgagtatcgcaacaacaaaagacaggaccaccctgactgtaaaggacagtatgagaggt
gactctggcagatacttcctgaccctagaaaacacagccggtgttaaaacatttactatc
acagttgtggtcattggaagaccagggccagtaactggtcccattgaggtctcatctgtc
tcggctgaatcatgtgtcctatcatggactgaaccaaaagacgatggaggcactgaaatt
acaaattatatagttgaaaagcgcgagtcgggtaccaccgcctggcagcttatcaattct
agtgtgaagcgcacgcagattaaagtcacacacctcacaaaatacaaagaatactgtttc
cgggtcagctcagagaatagattcggggtcagcaagcctctggaatcagtgccaatagtt
gctgaacatccatttgttccaccaagtgctcctaccaggcctgaggtctactatgtgtct
gccaatgctatgtcaattcgttgggaagaaccctaccatgatggcggtagtaaaatcgtt
ggctactgggttgagaagaaagaacgtaacaccattctttgggtgaaagaaaacaaagtg
ccgtgcttagagtgtaactacaaagtgacaggcttggtagaaggactggagtatcagttc
cgaacatatgcactcaatgctgcgggcgtcagcaaggccagtgaagcttcaagacctatc
atggctcaaaatccagttgatccacctggtaggccagaagtgacagatgtcacaagatca
acagtgtcactaatttggtctgccccagtgtatgacggaggcagcaaagttgtgggctac
atcatagaacggaagccagtcagtgaagttggagatggtcgctggctgaagtgcaactat
accattgtctctgataatttcttcactgtgaccgctctcagcgaaggggacacttatgaa
ttccgtgtgttggccaagaacgcagcaggcgtaattagcaaaggctctgaatctacaggc
cctgtaacttgccgagatgaatatgctccaccaaaagctgaattggatgccaggttacaa
ggcgatctggtgaccatcagagcaggttcagatcttgttcttgatgctgctgttggtggc
aaacctgaacccaaaatcatctggaccaaaggagacaaggaactggatctctgtgaaaaa
atttctctacagtacactggcaagcgagccactgctgtgatcaaatactgtgaccggagt
gacagtgggaaatacacactgacagtgaagaacgctagtgggaccaagtccgtatctgtc
atggtcaaagttcttgattctcctggcccatgtggaaaactcactgtcagcagagtgacc
gaggagaagtgcaccttagcctggagccttccacaggaagatggaggagcagagataact
cactatattgtagagagacgggagactagcaggctcaattgggtgatcgtggaaggggaa
tgcctgaccgcatcctacgtggttaccagactcatcaagaacaatgaatacacattccgc
gtgagggcagtgaacaagtacggcctcggcgtgccagttgagtcagagcctattgtggcc
agaaactctttcacgattccatcacaacctggcataccagaagaagttggggctggcaaa
gagcacatcattattcagtggacgaaacctgaatctgatggtggcaatgaaatcagcaac
tacctcgtcgacaaacgggagaagaaaagcttgcgctggacccgtgtcaacaaagactac
gtggtgtacgacaccaggctgaaggtgaccagcctcatggaaggctgtgattatcagttc
cgagtgactgccgtgaacgctgctggcaacagtgagcccagtgaagcttcaaacttcatc
tcatgcagagagccatcatacacccctgggccaccttctgctccaagagttgtggatacc
accaagcgcagcattagtttggcatggaccaagcccatgtacgacggtggtactgacatc
ataggatacgtccttgaaatgcaagagaaggacacagatcaatggtgccgagtacataca
aacgccacgataagaaacaacgaattcactgtgcctgaccttaagatgggccagaagtac
tccttcagggttgctgctgtgaacgccaagggtatgagtgactacagtgagacgactgct
gaaattgagcccgtggaaagactagaaataccagatcttgagcttgcagatgatctgaag
aagaccgtgattgtcagggctggagcctccttgcgcctgatggtgtctgtctctggaaga
ccttctcctgtcatcacgtggagcaaaaaaggcattgaccttgcaaatcgggcaattatt
gacaacacagagagctactctttactcattgtagacaaagttaatcggtatgatgctgga
aaatacacaattgaagctgaaaatcagtctggcaagaaatcagcaacggtcctagttaaa
gtctatgatactcctggtccctgcccttcagtgagcgttaaagaagtttcgagagattct
gtgaccatcacttgggaaatccccacaattgatggtggtgctccggtcaacaattacatt
attgagaagcgagaagccgccatgagggcattcaagacagtaaccaccaaatgcagcaag
actctttaccgcatatctggactcgtcgagggaaccatgtactactttagagtgcttcca
gaaaacatctatggcatcggagagccttgcgaaacatcagacgcagttctagtctcagaa
gtacctttggtgcccacaaaactagaagtggttgatgtcaccaaatccactgtgaccctt
gcttgggagaaaccactctatgacggtggaagccgactcaccggatatgttcttgaggcc
tgcaaagccggcaccgagagatggatgaaagttgtcactttgaaacccacagtcttagag
cacactgttatttccctgaatgaaggcgagcagtacttgtttagagtgagggctcaaaat
gagaaaggtgtgtcagaaccgagagagatcgtcacaccagtgacagtacaagacctcaga
gtgttgccaacgattgacctttccacaatgccccaaaagaccatccatgtcccagctggc
agaccaattgagctggtgataccgatcactggtcggccgccacctactgcttcctggttc
tttgctggttctaaactgagagaatcagagcgtgtcacagttgaaacccacactaaagtc
accaagctaaccatccgtgaaactactataagagatacgggagaatatacgcttgaacta
aagaatgttactggaaccacctcagagacaataaaagttattattcttgacaagcctggt
ccaccaactgggcccatcaagattgatgaaattgatgccacgtcagttacgatatcctgg
gaacctcccgaattggatggtggtgctccactgagtggctatgtggtagagcagcgtgat
gctcatcgtccaggatggctgccagtttctgagtctgtaacaagaccaacgtttaagttt
accagactcaccgaaggaaatgaatacgtgttccgcgtggctgcaacaaaccgcttcggg
attggctcgtacttgcagtctgaggtcatagaatgccgaagcagcatcagtattcctgga
cctccagaaacattacagatatttgatgtctcccgtgatggcatgacacttacatggtat
ccacctgaagatgatggtggctcccaagtgactggatatatcgtggaacgtaaagaagta
agagctgatcggtgggtccgtgtaaataaagtaccagtgactatgacccggtaccgctcc
accggccttattgaaggcttagaatatgaacatcgggtcacagccattaatgcaagagga
actggaaaaccaagtcgtccttccaaacccaccgttgccatggatccaattgctccacca
ggaaaaccacaaaatccaagagttacagatacaacaaggacttcagtctccctggcctgg
agtgttccggaagatgaaggtggatctaaagtcacagggtacttgatcgaaatgcaaaaa
gtagatcaacgtgaatggaccaaatgtaacaccaccccaaccaagattcgggagtatacc
ctaacacacctacctcagggcgctgaatacagattccgtgtcctagcctgtaatgctggt
ggacctggagaacctgctgaggtaccaggaaccgtcaaagtcacagagatgctggaatac
cctgactatgaacttgatgagagataccaggaaggtgtctttgttcgacaaggtggggtc
atcaggcttaccatcccaatcaaaggaaaaccattcccagtatgtaaatggaccaaggaa
ggccaagacattagtaagcgtgccatgattgcaacatcggaaacacatactgagcttgtg
atcaaagaagcagacagaaacgattctggaacttacgacttggttctggaaaacaaatgt
ggcaagaagaccgtttacattaaggtcaaggtgataggaagtcccaacactccagaaggg
ccactggaatacgatgacatacaagcccgctctgtaagggtcagctggagacctcctgct
gacgatggtggtgctgacatcctgggctacatccttgagagaagagaggtacctaaggct
gcctggtataccattgactccagagtccgaggcacatctctggtggtgaaaggcctcaaa
gaaaacgtggaataccatttccgtgtctcagcagaaaaccagtttggcataagcaaaccc
ttgaaatctgaggagccagtcataccaaagacaccactgaatccaccagaaccaccaagc
aatcctcctgaagtacttgatgtgaccaaaagttccgttagcttgtcatggtctcgacct
aaagatgacggcggctctcgagtgacgggctactacattgagcgcaaggagacatccact
gacaagtgggtcagacacaacaaaacccagataaccaccacgatgtacactgtcaccggc
ctcgttcccgatgctgagtaccagttccgcatcatcgcacagaatgacgttggccttagt
gagaccagccctgcttctgaacctgttgtttgcaaagatccctttgataagccaagccaa
ccaggagaacttgagattctctcgatatccaaagacagtgtcaccctccagtgggagaaa
cccgaatgtgatggtggcaaagaaatccttggatactgggttgaatacagacagtctgga
gacagtgcttggaagaagagcaataaggaacggatcaaggacagacagttcaccatcggc
ggtttgctagaagctactgaatatgagttccgagtatttgctgagaacgagactgggctc
agccgaccacgtagaacagctatgtctgtcaagactaaactaacatctggagaagcccca
ggagtgcgcaaagaaatggctgatgtgaccaccaaattaggtgaagctgcacaactctca
tgccagatagttggaaggccccttcctgacattaaatggtaccggtttggtaaagagctc
atacaaagccggaagtacaaaatgtcctcagatgggcgcacgcatactctgacagtaatg
acagatgaacaagaagatgaaggtgtttatacatgtgtagccacaaatgaagtaggagaa
gtagaaagcagcagcaagcttcttctgcaagcggcaccacagttccatcctggttaccca
ctgaaagagaagtattacggggccgtggggtctacgcttcggctccacgttatgtatatt
ggccgcccagtacctgccatgacttggttccatggccagaaacttttgcaaaactcagaa
aaaatcaccattgaaaacactgagcactatactcaccttgtcatgaagaatgtccaacga
aagactcatgctgggaaatacaaggttcagctcagcaatgcctttgggacagtggatgcc
accctagatgtggaaatacaagataaaccagacaagcctactggacccattgtgattgaa
gcactactcaagaactcggtggtgatcagctggaaaccacctgctgatgatggcggctcc
tggatcaccaattacgtggtagagaaatgtgaggccaaagaaggtgctgaatggcaattg
gtgtcttcagccatctcggtgacaacctgcagaattgtgaacctcacagagaatgccggc
tactatttccgggtctcagctcagaacacctttggcatcagtgagccactagaggtcgcc
tccattgtgatcatcaagagtccattcgaaaagccaggtgttcctggtaaaccaaccatc
actgctgtcacaaaggattcttgtgttgtggcttggaagccacctgcaagcgatggcggt
gcaaagatcagaaattactaccttgagaggcgcgagaagaagcaaaacaagtggattgct
gtgacgacagaggaaattcgagaaaccgtcttctcagtgcaaaaccttattgaaggtctt
gaatatgagttccgtgtgaaatgtgaaaacctgggtggagagagtgaatggagtgaaata
tcagaacccgtcactccaaaatccgacgtcccgattcaggctccacacttcaaggaggag
ctgagaaacctgaatgtaaggtatcagagcaacgccactctggtctgcaaggtgaccggt
cacccaaagcctattgtgaaatggtacagacaaggcaaagaaattatcgccgatggactc
aagtacaggattcaagaatttaagggcggttaccaccagctcatcattgcaagcgtcaca
gatgatgatgccacggtgtaccaagtcagagccaccaaccaagggggctccgtgtctggc
actgcttccttggaagtggaagttccagctaagatacacttgcccaagactctcgaaggc
atgggagcggtccatgctctccgaggggaagtggttagcatcaagatccccttcagtggt
aagccagaccccgtgatcacctggcagaaaggacaagatctcatcgacaataatggccac
taccaagtgattgtcacaagatccttcacgtcacttgtcttctccaatggagtggagaga
aaagatgctggcttctatgtcgtctgtgctaaaaacagatttggaattgatcaaaagaca
gtcgaactggatgtggctgatgtccccgacccacccaggggtgtcaaagttagtgacgtc
tcacgcgattctgtcaacttaacatggacagagccagcttctgatggtggtagcaaggtc
accaactacatcgtggaaaagtgtgcaactactgcagaaagatggctccgagtgggacag
gcccgagaaacccgttacactgtgatcaacttgtttggaaaaacaagttaccagttccga
gtaatagctgaaaataaatttggcctgagcaagccatcagagccctcagaaccaaccgtt
accaaagaagataagaccagagctatgaattatgatgatgaggtggatgaaaccagagag
gtcaccacgactaaagcatcacactccaaaactaaagaactctacgagaaatacatgata
gctgaagatctggggcgtggtgagtttggaattgtccaccgttgcgttgaaacatcctca
aagaggacattcatggccaaatttgttaaagtcaaaggaaccgatcaggttttagtcaag
aaagagatttccattctaaacattgctaggcacaggaacatcttatacctccatgaatca
tttgaaagcatggaagagttagttatgatctttgaatttatatcaggactcgacatattt
gaacgcatcaacacgagcgcctttgagcttaatgaaagagaaattgtaagctatgtccgc
caagtctgcgaagcactggagttcttacatagccagaatattggccactttgacattcga
ccagaaaatatcatttaccagacaagaaagaactccactattaaaataatagagtttggt
caagcccgtcagctgaagccaggagacaactttaggctgctgttcactgcccctgaatac
tatgcccctgaagtccaccagcatgatgttgtcagcactgccacagacatgtggtcgctt
ggtacattggtgtatgtgctactgagtggaatcaacccatttttggctgaaactaaccaa
cagatgattgagaacatcatgaacgctgaatatacttttgatgaagaagccttcaaagaa
attagccttgaagcgatggattttgtcgaccggctattggtgaaagagcgaaaatctcgc
atgacagcatcagaggccctgcagcacccatggctgaagcaaaggatcgacagagtcagt
actaaagtcatcagaacactgaaacaccggcggtactaccacaccctgataaagaaagac
ctcaatatggttgtatcagcagcccggatctcctgtggtggtgcaatacgatctcagagg
ggagtgagcgtggctaaagttaaagttgcatccattgaaattggtccggtctctgggcaa
ataatgcacgccattggcgaagaaggcgggtatgtcaaatatgtttgcaagatcgaaaat
tatgatcagtctacccaggtgacctggtactttggcgtgagacagctggaaaacagtgag
aaatatgaaatcacctatgaagatggagtggccaccatgtatgtcaaagacatcaccaaa
tttgatgatgggacctacagatgcaaagtcgtcaatgactacggtgaagatagctcttac
gcagagctgttcgttaaaggagtgagggaagtttatgactactattgccgccgaaccaag
aaagtcaagcgcagaacagatgcgatgcggctccttgaaaggccaccagaatttaccctg
cctctctataacaagacggcatacgtgggtgaaaatgtccgttttggagtaactattacc
gtccacccagaacctcgtgtgacgtggtataaatcaggtcagaaaatcaagccaggtgat
gatgaaaagaaatacacattcgagtctgacaagggtctttatcaattaacaatcaacagc
gtgaccacagacgatgatgctgaatacaccgttgtggcaaggaacaaacatggtgaagac
agctgtaaagcaaagctgacggtgactttacatccacccccgacggaaaccacgctcaga
cccatgttcaagcggctgctggcaaatgccgaatgccatgaaggccaaagtgtctgcttt
gagatcagagtttctggcatccctgcaccaacattaaaatgggagaaggatggccagccg
ctgtccctcgggccccacattgaaattgtccatgaaggcttagattattatgcactgcat
atcagggacactttgccggaagacacaggttattacagagtcacggccacaaacacggcc
ggatccaccagctgccaggctcacttacaggtagagcggttgcgctacgtaaagcaggaa
ttccagagtaaagaggaacgtgagcgccatgtccaaaaacagattgacaagacactgagg
atggctgaaatcctttctggaactgaaactgtgccattgactcccgtagcccaagaggct
ctgcgagaagctgccattctttacaaaccagcagtgagcaccaagactgtcaaaggagaa
taccgacttcagacggaggaaaagaaagaggagagaaaactccgcatgccttacgaagtc
ccagagccccgcaggttcaaacaagccacagtagaagaagaccagcgcatcaagcagttc
gtgcctatgtctgacatgaagtggtataagaagatccgggatcaatatgaaatgcctggg
aaacttgacagagttgtccagaaaaggcccaagcgcatccgcctttcaagatgggaacag
ttctatgtgatgcctcttcctcgcattactgaccaataccgacctaaatggcggatcccc
aaactgacccaagacgatctggaaatggtgaggccggcccgacggcgtaccccttcccca
gattatgatctttactattatagaaggaggagacgctctctgggtgacatgtcagatgag
gaactgctcctccccattgatgactacctggcgatgaagagaaccgaggaagagaggctg
cgtctggaggaggagcttgaactgggcttctcggcttcacctcccagccgaagccccccg
aggtttgagctgtctagcctgcgctattcttcaccgccagctcatgtcaaggtggaagac
agaagaagagacttcaggtactcgacctatcacgtccccacaaaggaggaaaccagcacg
agttatgcagagctgcgggaacggcatgcccaggcctcatacaggcagccgaagctacgg
cagagaatcatggccgagaaggaggaagaggagctactgcggccagtgacaaccacccag
cgtctctcagaatacaagagtgagctggactacatgtcaaaagaagaaaagtctaaaaag
aaatcaaaacgacagagacaagtgacagaaataacggaaatcgaagaggaatacgaaatc
tcaagacgggctcaaagggaatcatcctcctccgtgtccagactactgagacgccgtcgc
tccttgtctccaacttatattgagttaatgagaccagtgtctgagctgattcggtcccat
ccacgacctgctgaggaatatgaagatgatgcagaaagaaggtctcctactccagagaga
actcgcccacgttctcccagccctgtgtctagcgagcgatccctctcaagatttgagagg
tctgcaagatttgacatcttctccaggtacgagtccatgaaagctgccttaaaaactcag
aagacatcggaaaggaagtatgaggttttgagtcagcagcctttcacactggaccatgcc
cctcgaatcacactgcggatgcgctcccacagggttccctgtggccaaaacacacgcttc
atcctaaacgtccagtcgaagccgactgccgaagttaaatggtaccacaatggtgtagaa
ctccaagagagcagtaagattcattacaccaacacaagtggggtcctgaccttggagatt
ctggactgccagactgaggacggtggaacctaccgtgccgtgtgcaccaactacaaagga
gaggcatcagactacgcaaccctggatgtaactggcggagcttataccacctatgcatcc
cagcgcagagatgaggaggtccccaagtcagtcttccctgaactgacaaaaacagaggca
tatgcagtctcgtcgttcaagagaacatctgagctggaagctgcttcttcagtcagggaa
gtgaagtcacaaatgacagagacgagggaaagtctctcaacctatgagcattacgcctct
gcggaaatgaaaagcgccacatcagaggaaaagtcactggaagaaaaagccacggtgaga
aagattaagacaacactggcagcaagaattttaaccaagccacgctccataactgtccat
gaaggtgagtctgcgaggttttcctgcgacactgatggggagccggtaccaacagtgacc
tggctgcgtgaaggacaagtggtgagtacttctgctcgccaccaagtgaccaccaccaag
tacaagtcgacctttgagatttcttcagttcaggcctctgatgagggcaactacagcgtg
gtagttgaaaacagcgatgggaagcaagaagcacagttcaccctgaccgtgcaaaaggcc
agggttattgaaaaggctgtgacgtcaccacccagagtcaagtccccagagcctcgggtg
aagtccccagaaacagtgaagtctcccaaaagagtgaaatctccagaaccagtaacttct
catccaaaagccgtgtcacccacagagacaaagccaacagagaagggtcaacatctccca
gtctctgccccaccaaagataactcagtccctgaaagcagaagcttctaaagacattgca
aagctgacctgtgcggttgaaagtagtgcactgtgtgcaaaagaggtcgcctggtataaa
gatggcaagaaactcaaggaaaatgggcattttcaatttcattactcagcagatgggacc
tacgaactcaaaattcacaaccttagcgaatctgattgcggagagtatgtttgtgaggtc
tctggtgaaggaggaacttccaaaaccagcttccagtttactggacaatccttcaagagt
atccatgagcaggtgtcaagcatatcagaaactacaaaatcggttcagaaaactgctgag
tcagcagaagccaagaaatccgctcagaaaactgctgagtcagtagaagataagaaagca
gcacagaaaactgtggaatcagcagaagcaaagaagccagcacagaaaactgctgagtca
ccagaagccaagaaacctgcacagaaaactgctgagtcaccagaagccaagaagcaggaa
ccaatagctcctgaatcaatttcctcaaagccagtaattgttactgggctgcgggataca
acagtttcttcagacagtgttgctaaatttacaattaaagttactggagagccccagcca
actatcacctggacaaaggatggaaaggctattgcacaaggcagtaaatacaaactctct
agcaacaaagaagaattcatcttagaaatcctcaagaccgagacatctgatggcggactt
tacgcctgtacagtaacaaattctgctggatctgtgtcctcgagctgcaagctgacaata
aaagctgtaaaagacaccgaggcacagaaagtatctacccagaagacctccgaagtcaca
tctcagaagaaagcgagtgcccaagaggaaatttctcaaaaagccctaacttctgaagaa
atcaaaatgtcagaagtaaaatctcatgaaacgctggccatcaaggaggaagcgtccaaa
gttctgattgctgaggaggtcaagaggtcagcagcagcctccctggagaaatccatcgtc
catgaagaagtcaccaaaacctcacaggcatccgaagaagtcaaaactcacgcggagatc
aaaacactgtctacccagatgaacataaccaagggccagcgagcgaccctgaaagccaac
attgctggggccacagatgtgaaatgggtcctgaacggcactgagcttccgaactcagag
gaatacagatacggggtatctggcagtgaccaaactctcaccatcaaacaagccagtcac
agagaggaagggatcctcagctgcataggcaaaaccagccagggagttgtcaagtgtcag
tttgacttgaccctgagtgaagaactctcggatgctccaagcttcatcacacagcccaga
tctcaaaacattaacgagggacaaaatgttctcttttcttgtgaggtcagcggggagccg
tcccctgaaattgagtggtttaaaaataaccttccaatttccatttcttcaaatatcagt
gtgagtcgctccagaaacgtgtacactcttgaaatccgaaatgcggctgtaagtgacagc
ggaaagtacacaattaaggctaagaatttccacggccagtgctctgcaacagcgtccctc
acagtgctccctctggtggaagaaccaccgagagaggtggtattgaaaacgagcagtgac
gtgagcttgcacggaagcgtctcgtctcagtcagtccaaatgtctgcctctaagcaggag
gcatccttcagcagcttcagcagcagcagcgctagcagcatgactgaaatgaagtttgcg
agcatgtctgcccaaagcatgtcttccatgcaagagtcctttgtagaaatgagttccagc
agttttatgggaaaatctagcatgacacaactggaaagctcaaccagtagaatgctcaaa
gcaggcggaagaggaattccacctaaaattgaagctcttccctctgatatcagcatcgac
gaaggcaaagtcctaacagtagcctgtgcctttactggggagcctactccagaaataaca
tggtcctgtggtggaaggaaaatccaaaaccaagaacaacaaggaagattccacattgaa
aacacagatgacctgaccaccctgatcatcatggacgtacagaaacaagatggcggactt
tataccctaagcttagggaatgaatttggatctgactctgccactgtgaatattaatatc
cgttctatgtaa

DBGET integrated database retrieval system