KEGG   Mus musculus (mouse): 22146
Entry
22146             CDS       T01002                                 

Gene name
Tuba1c, M[a], M[a]6, Tuba, Tuba6
Definition
(RefSeq) tubulin, alpha 1C
  KO
K07374  tubulin alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04210  Apoptosis
mmu04530  Tight junction
mmu04540  Gap junction
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    22146 (Tuba1c)
  09143 Cell growth and death
   04210 Apoptosis
    22146 (Tuba1c)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    22146 (Tuba1c)
   04540 Gap junction
    22146 (Tuba1c)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    22146 (Tuba1c)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22146 (Tuba1c)
   05012 Parkinson disease
    22146 (Tuba1c)
   05014 Amyotrophic lateral sclerosis
    22146 (Tuba1c)
   05016 Huntington disease
    22146 (Tuba1c)
   05020 Prion disease
    22146 (Tuba1c)
   05022 Pathways of neurodegeneration - multiple diseases
    22146 (Tuba1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    22146 (Tuba1c)
   03036 Chromosome and associated proteins [BR:mmu03036]
    22146 (Tuba1c)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22146 (Tuba1c)
   04147 Exosome [BR:mmu04147]
    22146 (Tuba1c)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     22146 (Tuba1c)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     22146 (Tuba1c)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    22146 (Tuba1c)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22146 (Tuba1c)
  Exosomal proteins of other body fluids (saliva and urine)
   22146 (Tuba1c)
  Exosomal proteins of colorectal cancer cells
   22146 (Tuba1c)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 22146
NCBI-ProteinID: NP_033474
MGI: 1095409
Ensembl: ENSMUSG00000043091
UniProt: P68373 Q52L87
Position
15; 15 F1
AA seq 449 aa
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGADSAEGDDEGEEY
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgcgtgagtgcatctccatccacgttggccaggctggtgtccagatcggcaatgcctgc
tgggagctctactgcctggaacatggcatccagcctgatggccagatgccaagtgacaag
accattgggggaggagatgactccttcaacaccttcttcagtgagacaggagctggcaag
catgtgccccgggcagtgttcgtagacctggaacccacggtcatcgatgaagttcgcacc
ggcacctaccgccagctcttccatcctgagcagctcatcacaggcaaggaggatgctgcc
aataactatgcccgtggccactacaccattggcaaggagatcattgaccttgtcctggac
aggattcgcaagctggctgaccagtgcacgggtctccagggcttcttggttttccacagc
tttggtgggggaactggctctggcttcacctccctgctgatggagcggctctctgtggat
tacggaaagaagtccaagctggagttctccatttacccagccccccaggtttccactgct
gtggttgagccctacaattccatcctcaccacccacaccaccctggagcactctgattgt
gccttcatggtagacaatgaggccatctatgacatctgtcgtagaaacctcgacattgag
cgcccaacctacaccaaccttaaccgccttattagccagattgtgtcttccatcactgct
tccctcagatttgatggggccctgaatgttgatctgacagaattccagaccaacctggta
ccctaccctcgcatccacttccctctggccacttatgcccctgtcatctctgctgagaaa
gcctaccatgagcagcttacagtagcagagatcaccaatgcctgctttgagccagccaac
cagatggtgaaatgtgaccctcgccatggtaaatacatggcttgctgcctgctgtaccgt
ggtgatgtggttcccaaagatgtcaatgctgccattgccaccatcaagaccaagcgtacc
atccagtttgtggactggtgccccactggcttcaaggttggcattaactaccagcctccc
actgtggtacccggtggtgacctggccaaggtgcagagagctgtgtgcatgctgagcaac
accacagccattgctgaggcctgggctcgcctagatcacaagtttgatctgatgtatgcc
aagcgtgcctttgtgcactggtatgtgggtgagggcatggaggagggtgagttctctgag
gcccgtgaggacatggctgccctagagaaggattatgaggaggttggggcagatagtgct
gaaggagacgatgagggtgaggaatattaa

DBGET integrated database retrieval system