KEGG   Mus musculus (mouse): 22152Help
Entry
22152             CDS       T01002                                 

Gene name
Tubb3, 3200002H15Rik, M(beta)3, M(beta)6
Definition
(RefSeq) tubulin, beta 3 class III
  KO
K07375  tubulin beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04540  Gap junction
mmu05010  Alzheimer disease
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    22152 (Tubb3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    22152 (Tubb3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22152 (Tubb3)
   05016 Huntington disease
    22152 (Tubb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    22152 (Tubb3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22152 (Tubb3)
   04147 Exosome [BR:mmu04147]
    22152 (Tubb3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     22152 (Tubb3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    22152 (Tubb3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22152 (Tubb3)
  Exosomal proteins of colorectal cancer cells
   22152 (Tubb3)
  Exosomal proteins of bladder cancer cells
   22152 (Tubb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 22152
NCBI-ProteinID: NP_075768
MGI: 107813
Ensembl: ENSMUSG00000062380
Vega: OTTMUSG00000027611
UniProt: Q9ERD7
Position
8; 8 E1
AA seq 450 aa AA seqDB search
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYV
PRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRG
LKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEMYEDDDEESEAQGPK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagggagatcgtgcacatccaggccggccagtgcggcaaccagataggggccaagttc
tgggaggtcatcagcgatgagcacggcatagaccccagcggcaactatgtaggggactca
gacctgcagctggagcgcatcagcgtatactacaatgaggcctcctctcacaagtatgtg
cccagggccattctggtggacttggaacctggaaccatggacagtgttcggtctggcgcc
tttggacacctattcaggcccgacaactttatctttggtcagagtggtgctggcaacaac
tgggccaaagggcactatacggagggcgcggagctggtggactcagtcctagatgtcgtg
cggaaagagtgtgagaattgtgactgcctgcagggcttccagctgacacactcactgggt
gggggcacaggctcaggcatgggcacactgctcatcagcaaggtgcgtgaggagtacccc
gaccgcatcatgaacaccttcagcgtggtgccttcacccaaagtgtcggacactgtggtg
gagccctacaacgccaccctgtccatccaccagctagtggagaacacagacgagacctac
tgcatcgacaatgaagccctctacgacatctgcttccgcaccctcaagctggccacaccc
acctatggggacctcaaccaccttgtgtctgccaccatgagtggagtcaccacctccctt
cgattccctggtcagctcaatgccgacctccgcaagctggctgtgaacatggtgccgttc
ccacgtctccacttcttcatgcccggcttcgccccacttacagcccggggcagccagcag
taccgtgccctgacggtgcctgagctcacgcagcagatgttcgatgccaagaacatgatg
gctgcctgtgacccgcgccacggtcgctacctgaccgtggccactgtcttccgtgggcgc
atgtctatgaaggaggtggacgagcagatgctggccatccagagtaagaacagcagctac
ttcgtggagtggatccccaacaacgtcaaggtagccgtgtgtgacatcccaccccgtggg
ctcaaaatgtcatccaccttcattggcaacagcacggccatccaggagctgttcaaacgc
atctcggagcagttcacagccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggatgagatggagttcaccgaggccgagagcaacatgaatgacctggtgtcc
gagtaccagcagtaccaggacgccactgcggaggaggagggggagatgtatgaagatgat
gacgaggaatcggaagcccaggggcccaagtga

DBGET integrated database retrieval system