KEGG   Mus musculus (house mouse): 22154
Entry
22154             CDS       T01002                                 
Symbol
Tubb5, AA408537, AI596182, B130022C14Rik, M(beta)5
Name
(RefSeq) tubulin, beta 5 class I
  KO
K07375  tubulin beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04145  Phagosome
mmu04540  Gap junction
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    22154 (Tubb5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    22154 (Tubb5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    22154 (Tubb5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22154 (Tubb5)
   05012 Parkinson disease
    22154 (Tubb5)
   05014 Amyotrophic lateral sclerosis
    22154 (Tubb5)
   05016 Huntington disease
    22154 (Tubb5)
   05020 Prion disease
    22154 (Tubb5)
   05022 Pathways of neurodegeneration - multiple diseases
    22154 (Tubb5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    22154 (Tubb5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22154 (Tubb5)
   04147 Exosome [BR:mmu04147]
    22154 (Tubb5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    Other tubulins
     22154 (Tubb5)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    22154 (Tubb5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22154 (Tubb5)
  Exosomal proteins of colorectal cancer cells
   22154 (Tubb5)
  Exosomal proteins of bladder cancer cells
   22154 (Tubb5)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 22154
NCBI-ProteinID: NP_035785
MGI: 107812
Ensembl: ENSMUSG00000001525
UniProt: P99024
Position
17:complement(36144812..36149193)
AA seq 444 aa
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEEDFGEEAEEEA
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagggaaatcgtgcacatccaggccggacagtgtggcaaccagatcggtgctaagttc
tgggaggtgataagcgatgaacatggcatcgaccccaccggtacctaccacggtgacagc
gacctgcagctggaccgaatctctgtgtactataatgaagccacaggtggcaagtatgtc
cctcgagctatcttggtggatctagaacctgggactatggactccgttcgctcaggtcct
tttggccagatcttcagaccagacaacttcgttttcggtcagtctggggcaggcaacaac
tgggctaaaggccactacacagagggagctgagttggttgactctgtcttggatgtggtg
cggaaggaggcggagagctgtgattgcctgcaaggctttcagctgacccactcactgggt
ggaggcactggctctggcatgggcaccctgctcatcagcaagatccgggaagaatatcct
gaccgtatcatgaataccttcagtgtggtgccctcgcccaaagtgtctgataccgtggtc
gagccctacaatgccaccctgtctgtccatcagttggttgagaacacggatgagacctac
tgcatcgacaacgaggccctctacgacatctgcttccgtaccctcaagctcaccacgcca
acctacggagacctgaaccatctcgtctcggccaccatgagcggcgtcaccacctgcctc
cgtttcccgggccagcttaatgctgaccttcgaaagctggctgtcaacatggtgccattc
ccacgtctccacttcttcatgcctggctttgcccctctcaccagccgtggaagccagcag
taccgggccctcactgtgcctgaacttacccagcaggtcttcgatgccaagaacatgatg
gccgcctgcgacccgcgccacggccggtacctcacagttgccgccgtcttccgtggacgg
atgtccatgaaggaggtggatgagcagatgctcaacgtgcagaacaagaatagcagctac
ttcgtggaatggatccccaacaatgtcaagacagctgtctgtgacatcccaccgcgtggc
ctcaagatggcagtcaccttcattggaaacagcacagccatccaggagctcttcaagcgc
atctctgagcagtttacggctatgttccgccggaaggctttcctccactggtatacgggt
gagggcatggacgagatggagttcaccgaagctgagagcaacatgaacgacctcgtctct
gagtaccagcagtaccaggatgccaccgcggaagaggaagaggatttcggagaggaggca
gaagaggaggcctaa

DBGET integrated database retrieval system