KEGG   Mus musculus (house mouse): 22156
Entry
22156             CDS       T01002                                 
Symbol
Tuft1
Name
(RefSeq) tuftelin 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF4200 Filament Fez1 Crescentin Bacillus_HBL HOOK
Other DBs
NCBI-GeneID: 22156
NCBI-ProteinID: NP_035786
MGI: 109572
Ensembl: ENSMUSG00000005968
UniProt: O08970 Q3V1F5
Position
3:complement(94520060..94566179)
AA seq 390 aa
MNGTRNWCTLVDVHPESQTAGSVDILRLTLQSELTGDELEHIAQKAGRKTYAMMPGHSSG
HSLASELVESHDGHEEIIKVYLKGRSGDKMTHEKNIDQLKSEVQYIQEARNCLQKLREDI
SSKLDRSPGDPLRQQEIQVVLEKPNGFSQSPMTLYSSPPEVDPSMSEDVESLKKTVQELL
VKLREAERRHQSDRVAFEVTLSRYQREAEQSNVALQREEDRVEQKAAEIEELQRRLLGME
AEHQALLVKVREGEMALEELRIKNADCQTEREKSAALEKEVAGFREKIHHLDDMLKSQQR
KVRQMIEQLQNSKAVIQSKDATIQELKEKIAYLEAENLEMHDRMEHLIEKQVSHGNFSTQ
ARAKTENLGSVRISKPPSPKPMPLIRVVET
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaacgggacgcggaactggtgtaccttggtggacgtgcacccggagagccagaccgcg
ggcagcgtggacattctcaggctgacgctccagagtgaactgacaggagatgaacttgag
cacatagcccagaaggcgggcaggaagacctatgccatgatgcctggccactcctcaggt
cattctctggcttcagaactggtggagtcccatgatggccatgaagagatcattaaggtt
tacttgaaagggaggtctggggacaagatgacccatgagaagaacatcgaccagctgaag
agtgaggtccagtacatccaggaggccaggaactgcctgcagaagctccgggaggatata
agtagcaagcttgacaggagtccaggagaccctctgcgtcagcaggagatacaggtggta
ctagaaaagccaaatggctttagtcagagtcccatgactctctacagtagcccacctgag
gtggaccctagcatgagtgaagatgttgagagcttgaagaagactgtgcaggagttgctt
gtcaagctgcgggaggctgagcggcgacaccagtcagaccgtgtggcctttgaggtcaca
ctcagccgttatcagcgagaagcagaacagagtaatgtggcccttcagagagaggaggac
agagtggagcagaaagcggcagaaatcgaggagctacagaggcgcttgctggggatggag
gcggagcatcaggccttactggtgaaagtcagggaaggagagatggccctagaagagctt
cggatcaagaacgctgactgtcaaacagaaagagaaaagtctgctgctctagaaaaggaa
gtggctgggtttcgggagaagatccaccacttggatgacatgctgaagagccagcagcgg
aaagttcggcagatgatagagcagctccagaattcaaaagctgtgatccagtcaaaggat
gccaccattcaagagctcaaggagaaaattgcctatctggaggctgagaacttagagatg
cacgaccgcatggagcatctaatagagaagcaggtcagccacggaaacttcagcacacag
gcccgtgccaagacagagaacctgggcagtgtcaggatatcgaagccccccagccccaag
cctatgcctctcatccgggtggtggaaacctga

DBGET integrated database retrieval system